KEGG   Drosophila virilis: Dvir_GJ11087Help
Entry
Dvir_GJ11087      CDS       T01066                                 

Definition
GJ11087 gene product from transcript GJ11087-RA
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
dvi  Drosophila virilis
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dvir_GJ11087
   01230 Biosynthesis of amino acids
    Dvir_GJ11087
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dvir_GJ11087
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dvir_GJ11087
Enzymes [BR:dvi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Dvir_GJ11087
Exosome [BR:dvi04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Dvir_GJ11087
  Exosomal proteins of melanoma cells
   Dvir_GJ11087
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 299 aa AA seqDB search
MSGLLRLGYGGHLLNLCFGSRQNRGAFLEPPKWISRELQRKYSHNCEKFTVVMVRHGESE
WNQQNLFCGWYDAQLSEKGRKEASAAGKAIKDAKLRFDVAHTSLLTRAQDTLQSILEVTG
QKDICIQKTWRLNERHYGGLTGLNKSETAKKYGEEKVKIWRRSFDTPPPPMEQDHKYYEC
IVKDPRYCDGPKPDEFPKSESLKLTIERTLPYWNDVIVPQIRQGRKLIIAAHGNSLRGIV
KHLDQISNEAIMELNLPTGIPFVYELDKCMLPLAPMKFLGDPETVKKAMESVAKQGKAK
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgtctgggctcttaagactgggctacggtggtcacctgctgaacctctgctttggcagc
agacagaacaggggcgcctttttggagccacccaaatggatatctcgggagctgcagcga
aaatattctcataattgtgagaaatttacagtagttatggtgcggcatggggagtccgag
tggaaccagcaaaatctcttctgcggctggtacgatgcccagctttcggagaaggggcgc
aaggaggcgagtgcggcgggcaaggccatcaaggatgccaagctgaggttcgacgtggcg
cacacatcgctattgacacgagcccaggacacattgcagtccatactggaggtgacggga
caaaaggatatatgcattcagaagacgtggcgtctcaatgagcgccactatggcgggctg
acgggactgaacaagtcggagacggccaagaagtatggcgaggagaaggttaagatctgg
cgacgtagcttcgatactccgccgccgccaatggagcaggatcacaagtactacgagtgc
atagtcaaggatcccagatattgtgatggacccaaaccggacgagtttcccaagtccgaa
tccctcaaactgaccatcgagcgcactttgccctactggaacgatgtgattgtgccgcag
ataaggcagggcagaaagctgatcatcgccgcacacgggaacagcctgaggggcattgtg
aagcatctggatcagatttccaatgaggccatcatggagctcaatctgcccactggcata
ccctttgtctacgagctggacaagtgcatgctgccgctggcgcccatgaaattcctgggc
gatcccgaaaccgtcaagaaggccatggaatctgtggccaagcagggcaaggcaaagtag

DBGET integrated database retrieval system