KEGG   Drosophila virilis: Dvir_GJ11129Help
Entry
Dvir_GJ11129      CDS       T01066                                 

Definition
GJ11129 gene product from transcript GJ11129-RA
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
dvi  Drosophila virilis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dvi00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:dvi00052]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 367 aa AA seqDB search
MVRVIEDVFGIAVNPMTQKTEHVRRFTLCSEKGMSVSILTLGATIQSVKVADFNGKLEDV
CLGYDDVAGYYRNQKSYFGATVGRVANRISRGHFKLCGKDVNVSRNFKDRYHLNGGFVGF
DSVIWDVVGIHKDGVTMQHVSPDGHEGYPGEVTVNINFSLNETGCFGMRIEARAKATTCI
NISNQNYFNLAGHGTGKDTLYQHMVMIRANSIVDSDKEQIPTGKLMPVRNTPYDFTTLTN
LGKRLNQVYRCPICGFDNNYCVDVDPNQVKLVARAVHPCSGRFMEVHTNQPGLQFCTANN
LPDEERDEIPNIGKDGAHYVQHGGFSMQTQKYPDAVNNSDFPTTIINPGQLYDHQVVYRF
GACPKRV
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggtacgcgtcatagaagatgtatttggcattgccgttaatcccatgacgcagaaaacc
gagcatgtgcgacgctttacattatgttcagaaaagggcatgtctgtgtcaatattgact
ctgggcgccactatacagagtgtaaaggttgcagactttaatggaaagctggaagacgtt
tgtctgggctatgatgatgtcgccggatattatcgcaatcagaaatcatattttggtgca
actgttggacgtgttgctaatcgtatatcccgcggtcactttaagctttgcggaaaggat
gtaaatgtgagccgaaattttaaggatcgctaccatctgaatggtggctttgtgggcttc
gacagcgtcatctgggacgtggtcggcattcataaggatggtgtcactatgcaacatgtt
tctccagatggccatgagggttatccgggcgaggtgacagtcaacattaatttctcgctt
aatgaaactggttgttttggcatgagaatcgaggcgcgtgctaaggcaaccacctgcatc
aatatatctaaccaaaattactttaatcttgccggccatggtactggcaaggacactctt
taccagcacatggtaatgataagagccaactcaattgtggactcggataaggagcaaata
cctaccggcaagcttatgccagtgcgtaatacaccttatgactttaccaccttaaccaat
ttgggcaagcgcctaaaccaggtttatcgctgcccgatctgcggctttgataacaactat
tgcgtcgatgtagacccgaatcaagtaaagttagtggcccgtgcagtccacccatgttcg
ggtcgttttatggaggttcataccaatcaacccggattgcagttctgtacggcaaataat
ttgccggatgaagagcgggatgaaatacccaatattggtaaggatggtgcgcattacgtt
caacatggcggattctccatgcagacccaaaagtatccagacgctgtgaataattccgat
tttccaacgaccattatcaatccgggtcaattgtatgatcatcaagttgtatacagattt
ggcgcatgtccgaaacgtgtgtaa

DBGET integrated database retrieval system