KEGG   Drosophila virilis: Dvir_GJ11234Help
Entry
Dvir_GJ11234      CDS       T01066                                 

Definition
(RefSeq) uncharacterized protein
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
dvi  Drosophila virilis
Pathway
dvi00010  Glycolysis / Gluconeogenesis
dvi00052  Galactose metabolism
dvi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dvir_GJ11234
   00052 Galactose metabolism
    Dvir_GJ11234
Enzymes [BR:dvi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Dvir_GJ11234
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldose_epim Desulfoferrod_N Vps36-NZF-N
Motif
Other DBs
NCBI-GeneID: 6623956
NCBI-ProteinID: XP_002048661
FlyBase: FBgn0198495
UniProt: B4LD96
Position
Unknown
AA seq 367 aa AA seqDB search
MVRVIEDVFGIAVNPMTQKTEHVRRFTLCSEKGMSVSILTLGATIQSVKVADFNGKLEDV
CLGYDDVAGYYRNQKSYFGATVGRVANRISRGHFKLCGKDVNVSRNFKDRYHLNGGFVGF
DSVIWDVVGIHKDGVTMQHVSPDGHEGYPGEVTVNINFSLNETGCFGMRIEARAKATTCI
NISNQNYFNLAGHGTGKDTLYQHMVMIRANSIVDSDKEQIPTGKLMPVRNTPYDFTTLTN
LGKRLNQVYRCPICGFDNNYCVDVDPNQVKLVARAVHPCSGRFMEVHTNQPGLQFCTANN
LPDEERDEIPNIGKDGAHYVQHGGFSMQTQKYPDAVNNSDFPTTIINPGQLYDHQVVYRF
GACPKRV
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggtacgcgtcatagaagatgtatttggcattgccgttaatcccatgacgcagaaaacc
gagcatgtgcgacgctttacattatgttcagaaaagggcatgtctgtgtcaatattgact
ctgggcgccactatacagagtgtaaaggttgcagactttaatggaaagctggaagacgtt
tgtctgggctatgatgatgtcgccggatattatcgcaatcagaaatcatattttggtgca
actgttggacgtgttgctaatcgtatatcccgcggtcactttaagctttgcggaaaggat
gtaaatgtgagccgaaattttaaggatcgctaccatctgaatggtggctttgtgggcttc
gacagcgtcatctgggacgtggtcggcattcataaggatggtgtcactatgcaacatgtt
tctccagatggccatgagggttatccgggcgaggtgacagtcaacattaatttctcgctt
aatgaaactggttgttttggcatgagaatcgaggcgcgtgctaaggcaaccacctgcatc
aatatatctaaccaaaattactttaatcttgccggccatggtactggcaaggacactctt
taccagcacatggtaatgataagagccaactcaattgtggactcggataaggagcaaata
cctaccggcaagcttatgccagtgcgtaatacaccttatgactttaccaccttaaccaat
ttgggcaagcgcctaaaccaggtttatcgctgcccgatctgcggctttgataacaactat
tgcgtcgatgtagacccgaatcaagtaaagttagtggcccgtgcagtccacccatgttcg
ggtcgttttatggaggttcataccaatcaacccggattgcagttctgtacggcaaataat
ttgccggatgaagagcgggatgaaatacccaatattggtaaggatggtgcgcattacgtt
caacatggcggattctccatgcagacccaaaagtatccagacgctgtgaataattccgat
tttccaacgaccattatcaatccgggtcaattgtatgatcatcaagttgtatacagattt
ggcgcatgtccgaaacgtgtgtaa

DBGET integrated database retrieval system