KEGG   Drosophila virilis: Dvir_GJ11246Help
Entry
Dvir_GJ11246      CDS       T01066                                 

Definition
GJ11246 gene product from transcript GJ11246-RA
Orthology
K06634  
cyclin H
Organism
dvi  Drosophila virilis
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    Dvir_GJ11246
  Replication and repair
   03420 Nucleotide excision repair
    Dvir_GJ11246
Transcription machinery [BR:dvi03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     Dvir_GJ11246
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 325 aa AA seqDB search
MYPLSSQKRSWTFANEGQLQAFRVEQNTKYIEEHETEAPSSGSLENFFLSPAEERLLLKQ
YEIYLVDFCRRFDPPMPKCVIGTAFHYFKRFYLNNTPMDYHPKEILATCVFVACKVEEFN
VSINQFVNNIKGDRNKATDIVLSNELLLIGQLNYYLTIHNPFRPIEGFLIDIKTRSNMQN
PDRLRPQIDSFIDSTFFTDACLLHTPSQIGLAAVLHAASKEQENLDSYVTDLLFVSAREK
LPGLIDAVRKIRMLVKNYQPPDREKVKAIEKKLDKCRNQNNNPDSELYKERLRRLYTDED
DMPAEDASFHIADVSSDTSAMNISQ
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgtatccgcttagctcacaaaaacgttcctggactttcgcaaacgagggtcagttgcaa
gcattccgggtggagcaaaacaccaagtacatagaagaacatgagactgaagcaccatcg
tcgggcagcctcgaaaacttctttctgtcaccggctgaggagcgactgctgctgaaacag
tatgaaatttatttggttgacttttgccgacgttttgatccgccaatgccaaaatgcgta
attggaactgcatttcattacttcaagcgtttttacttaaacaatacgcccatggactat
catcccaaggaaatattagctacatgtgtgtttgtggcctgcaaggtggaggaatttaat
gtatcgatcaaccagtttgtaaacaacataaaaggcgatcgcaataaagccaccgacatt
gtcctctcgaatgagctactattaattggccaactaaactattacctcacaatacacaat
ccgttccgcccgattgagggttttctaatagatatcaagactcgcagcaatatgcaaaat
ccagatcgtttgcgtccgcaaatagatagttttatcgattcaacgttcttcacggacgcc
tgcctgctgcacactccttcgcaaattggcctggctgcagtgctgcatgcggccagtaag
gagcaggagaatctagatagttatgtcacagacttactctttgtgtctgcgcgagagaag
cttccgggtctaattgatgcagtgcgcaaaatacgtatgctggtcaaaaactatcagccg
cctgatcgcgaaaaagttaaggccattgaaaaaaaattggacaagtgtcgcaatcaaaat
aacaatcccgacagcgaactatataaggagcgtttgcgacgtttatacaccgatgaggat
gacatgcccgccgaggatgcttcttttcacattgccgatgtcagttcggatacctccgcc
atgaatattagccaataa

DBGET integrated database retrieval system