KEGG   Drosophila virilis: Dvir_GJ11271Help
Entry
Dvir_GJ11271      CDS       T01066                                 

Definition
GJ11271 gene product from transcript GJ11271-RA
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
dvi  Drosophila virilis
Pathway
Other types of O-glycan biosynthesis
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:dvi00514]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 916 aa AA seqDB search
MSSHSVQRRKTTRSKSKQQQQQQQQQQRQNVAENLIENQNASNEQNERLHFRSRSATSVG
ALAAAAAAAAAPIDCNSTSPLCCNGMLPTTAITMLNCCRDINCHLNTPLALPLRGSVERS
RRSASRQSFLASETLKPTTTASPTPTSASKQSRSLSRSRSRSRSRSCSCDVGGNSCNIGD
PLRQSPDSAAAAKLTVSLHIDLISWGLFLLAFLTRFYKLATPPHVVFDELHYGKYISHYM
RNIFFFDQHPPLGKQLIAGLVSFVGYDGNYTFPRIGATYASNVPVFWLRFVPALCGSLLA
PAVYKLLLEAQLRRWAAALGGLLVVLDNALLTQSRFILMESMLLLASTVGIACLLRFQRC
SLGSLNWLSSGAAAALFLACAGCVKYVGFLALALAGYLLCRHLWKLLYDATLTNGQLWLH
ALGRLLLFVGIPLAVYLGVFYVHLKTLHRAGPHDTIMTSAFQASLDGGLASITRGQPLAV
VHGSQITLRHTHGRTCWLHSHAAVYPVRYKDQRGSSHQQQVTCYSFKDVNNWWIVKRPER
DDLVVGEQPDVIRHGDVIQLVHGITSRALNSHDVAAPMTPQCQEVSCYIDYEIKMAGELL
WRVEILNRQTEGDRWHAIKSEIRLIHETTGAALRFSGRQLPSWGFNQHEVVADRDPMHQD
AIWNVEEHRYTKTQDQRERERQLLSAEMIPTKRTKLSFWAKLLELQTKMFWHAKQVQSHM
YSSQPHEWPLLDKGIAYWLDDSSSAQIYLLGNVLIWYMASAGLFLYAALLVFYALRRRRL
CFDVSAGEWRRFLGAGDTFFVGYLVHYLPYFFVDRTLFLHNYLPAFVFKLLLLCYVLDHV
DYLLWSHCSRSRSRLAVHLVRIYRLALLLWLIAVCAVFIKFLPLSYGSRKMSAKEIIDLR
WKDTWDFILQKNYALQ
NT seq 2751 nt NT seq  +upstreamnt  +downstreamnt
atgtccagccacagcgtacagcgacgcaagacaacgcgctccaagtcgaaacagcagcaa
caacaacaacaacaacaacaacggcaaaatgttgcggaaaacctcatcgaaaatcaaaac
gcaagcaacgaacaaaacgaaagacttcactttcgcagccgttcagcaacctcagtcggt
gcactagcagcagcggcagcggcagcggcagcgccaatcgattgcaattcaacttcacca
ctatgctgtaatggcatgctgcccaccacagccatcaccatgctcaactgttgccgcgat
ataaactgccacctgaataccccgctggcgctaccattgcgcggcagcgttgagcgcagt
cgacgctcagcgagtcggcaatcttttctagcatcagaaacgcttaagccgacgacgaca
gcatcgcctacgcctacctctgcatctaagcagtcgcgttccctttcccgttcccgttcc
cgttcgcgttcgcgttcgtgttcttgtgatgtcggcggcaactcgtgcaatattggggat
cctctcaggcagagcccagacagcgctgcggcagcgaaattaaccgttagcctgcacatt
gatctcatcagctggggtctctttctgctggcgttcttaacgcgtttctataagctggca
acgccgccgcatgttgtcttcgatgagctgcattacggcaaatatatatcgcactatatg
cgcaacatcttcttcttcgatcagcatccgccactgggcaagcagctgatagctggcctt
gtcagctttgtcggctacgatggcaactacacatttccacgcattggcgccacctatgcg
tcaaatgtgcccgtcttctggctgcgctttgtgcccgcactttgtggaagtctgctcgcg
ccggccgtctacaagttgctgttggaagcgcagctgcgtcgctgggcagcagcgcttggc
ggcctgctcgttgtgttggacaatgctctgctgacgcagtcgcgtttcatactcatggaa
tcgatgctgctgctggccagcaccgtgggtattgcctgtctgctgcgcttccagcgctgc
tcgctgggcagcctcaactggctaagcagcggagcggcggctgcgctctttcttgcctgc
gccggctgcgtcaagtatgttggcttcctggcgctggcccttgccggttatttgctttgt
cgacatctctggaaactgctctacgatgcgactttgacaaatggccaactttggctgcac
gcactaggcagactgttgctgtttgtcggcattccgctggccgtttacctgggcgtcttt
tacgtgcacctaaagacgctacatcgggcggggccacatgacaccatcatgacgagtgcg
tttcaggcctcgctggacggcggcctggcgtcgattacacgcggccagccgttggctgtg
gtgcacggctcgcagataacgctgcggcatacgcacggacgcacctgctggctgcactcg
catgccgccgtgtatccggtgaggtacaaggatcagcgtggctcgtcgcatcagcagcag
gtgacatgctactcgttcaaggacgtgaacaactggtggattgtgaagcggccggaacgc
gatgatctggtggtgggcgaacagcccgatgtcatacgacatggcgatgtcattcagctg
gtgcacggcattaccagccgtgcgctgaactcgcacgacgtggcggcgcccatgacgccg
caatgccaggaggtcagctgctacattgactacgagatcaagatggccggtgagctgctg
tggcgcgtcgagatactcaaccgtcagaccgagggcgatcgctggcatgccatcaagtcg
gagatacgtcttatacacgagacgacgggcgccgcgctgcgcttcagtggccgccagctg
cccagctggggcttcaatcagcacgaggtggtcgctgatcgcgatccaatgcatcaggat
gccatttggaacgtggaggagcatcgctacaccaagactcaggatcagcgtgaacgtgag
cgccaattgctctccgccgagatgattcccaccaaacggaccaagctctcgttctgggcc
aagctgctcgagctgcagaccaagatgttctggcatgccaaacaggtgcagagccacatg
tacagctcccagccgcacgagtggccgctgctggacaagggcatcgcctactggctggac
gacagctccagcgcccaaatctatctgctgggcaatgtgctcatctggtatatggccagc
gcgggtctgtttctctatgccgcattgctagtcttttatgcgctgcgtcgccgtcgcttg
tgttttgatgtctccgccggagaatggaggcgcttccttggcgccggcgacaccttcttt
gtcggctatctggtgcactatttgccctatttctttgtggatcgtacgctctttctgcac
aactatctgccggcgtttgtcttcaagctgctgctgctctgctatgtgctcgaccatgtc
gactatctgctgtggagccactgcagccgcagtcgcagccgactagctgtgcatctggtg
cgcatctatcgtctggccctgctgctctggctgattgccgtctgcgcggtcttcatcaag
ttcttgccattgagctacggctccagaaagatgtccgccaaggaaatcatcgatttgcgc
tggaaggacacctgggactttatactccaaaagaattatgcattgcaataa

DBGET integrated database retrieval system