KEGG   Drosophila virilis: Dvir_GJ11329Help
Entry
Dvir_GJ11329      CDS       T01066                                 

Definition
GJ11329 gene product from transcript GJ11329-RA
Orthology
K11837  
ubiquitin carboxyl-terminal hydrolase 6/32 [EC:3.1.2.15]
Organism
dvi  Drosophila virilis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1765 aa AA seqDB search
MGTKESKHACISYEDAVKRVSDAELRRLKDAFKKSAGVGRLYLSRNAFQQDVLCEGVPPK
ITDMLYAACGGTQRGISFKDLLCGLVLITRGTQEEKTKFLWNLYCNDAGTYIIKSDYVRN
VSLAPFESVSLFAQSERVNFEQFQDWIVKHRNATVLSKWLLADNCVSLTSELETPTFYQS
LAGVTHLEEKDIGDLEKEFWRLKNTSQNGQIDLQFLGPLISPPIPKNALAGLFNAFDENR
DGHIDFKELCCGVSAACRGPGVERTRFCFKIFDVDRDGVLSHEETLQMINVLLFVAKENR
DAQQFKDLTKQHVISDLLEFAQRRSPDGVPSTLTRDNVSLTAEDFMLWNVQCGLRLMQPL
LDLIFELCHIVFGLWPQCKHMEFDIVRGWLQREERRPYRVGQFWYLISRDWWLTWMQYTQ
HTSHTCDYCKRTASQRSAVDEALVCDESFNTHSLEQHDSYSLGSVSGSSGISAGRHCGQQ
RPGPIDNSNLITTNPYRNVRTLTGEGGHLKRDTPLVQNHDFELVPKSLWKAVNRWYGDNL
PLPRQVIQPPNSEVELELYPLNLRILLHQVQTPTISGANTQITNWGSTVSGGYGVLASGG
GYAAIAASSVLQPPKRYLAYTAAFSRLATVRQVGEFLCEQLRLKPEDIRLWHVPPSSATL
DNSAILLEEDTMCLKELLIRDNDQLLLEIRNKDLTWPEELSSLASTQSGQAGAGPGDRRR
LTRTSIMSVHAPGATGLHNLGNTCFMNAALQVLFNTQPLAQYFHRQMHRFELNAANKLGT
RGQLAMRYAELLKEVWTATTRSVAPLKLRFCVNKHAPQFAGGGQHDSQELLEWLLDALHE
DLNRVMEKPYSELKDSNGRPDKIVAAEAWSQHHARNQSIIIDLFYGQLKSKVSCLCCGHE
SVRFDPFSLLSLPLPVENYVYLEVLVILLDGSVPIKYGVRLNSECKYGDLKHKLATLCPL
QPSLMLVCELWNSQIRQVLADEEKLRTQSSKELYVYQLPEQSNARTRSNSALSMHIEQGL
KDIQRSSALITTQDSLSSLSTLQTSNRTSSSRVICNGHLSDGQDAAGIDGDHELTKYKNN
NIGGSVGQVHELQPDDAGKESLILSCSPENNFMDDAAAQQKRISSTKLLHTESNTSSASY
TNHSGENSMESSLTEPMPVAELAVSRHGSNSDDGASYRNTNEHSSVRSAAHTLAVNSFDR
DVETDANEDDDDDDDVGQDEGEEPDQQITTSQPESTSGNQTSSGVYSRRSSQPYKVGKYL
VAVHRKITRHDSYFLSYHKTRPSLFGVPLLIPNCDGGTHKDLYCAVWLQVNRLLSPLPAT
TEQANHAADCDDSLGYDFPFTLRAVKADGLTCAICPWSSFCRGCEIRCNNDYVLQGALPP
ISCVANNIATPKMNEKCPSLPNLEAKRAPEYTTSLSYTPTTKYFEDFTIAIDWDPTALHL
RYQSTLERLWVDHETIAICRREQVEPVDLNHCLRAFTSEEKLEQWYHCSHCKGKKPATKK
LQIWKLPPILIVHLKRFNCVNGKWVKSQKVVHFPFDDFDPTPYLASVPQETILRHKELLE
LKRDLIGNSNEVPSELDEVDASDKADAVPSADAPPPTESAVGEKVATAKETPPTAGSVLR
QSKSSNAARRQRLISTSLTKTPIVDGEFEDYHQHKLQAGVDEFDPKYKLYAVVSHSGMLN
GGHYISYASNTTGSWYCYNDSSCREISQKPNIDPSAAYLLFYERQGLDYEPYLPNIEGRA
LPNAANLQLDVDESESELKKLCTIS
NT seq 5298 nt NT seq  +upstreamnt  +downstreamnt
atgggtacaaaagaatccaaacatgcttgcatcagttacgaggatgcagtcaaacgtgta
agcgacgccgagctgcgacgtctcaaagatgccttcaaaaagtcagctggcgttgggcga
ctctatctcagtcgcaatgcattccagcaggacgtgctgtgtgagggggtgccgcccaag
atcacggacatgctgtatgccgcctgtggtggtacacagcgcggcatatccttcaaggac
ctactgtgcggcctggtgctgatcacacgcggcacacaggaggagaaaaccaaatttctg
tggaacctgtactgcaatgatgctggcacctacatcatcaaatccgattacgtgcgcaat
gtgagcctggctcccttcgagagcgtctccttgtttgcgcaaagcgaacgcgtcaacttt
gagcagtttcaggactggatagtcaagcatcgcaatgcaacggtgctgtccaagtggctg
ttagctgacaattgtgtcagcctcacctcggagctggagacgcccaccttctatcagagt
ttggccggtgttacgcatcttgaagaaaaggatattggcgacttggagaaggagttctgg
cgcttgaagaacacctcacagaatggccaaatcgatttacaatttttgggaccgctcatc
agtccacccataccaaagaacgcgctggccggactatttaatgccttcgatgagaatcgt
gatggacatattgattttaaggagctttgttgtggcgttagtgccgcctgtcgtggaccc
ggcgtagagcgcactcgcttctgctttaagatctttgacgtggatcgagatggtgtgctc
agtcacgaggagacactgcaaatgatcaacgtgctgctgttcgtggccaaggaaaatcgc
gatgcgcagcaatttaaagatctgaccaagcagcatgtgatcagtgatctgctggagttt
gcccagcgcaggagtcccgacggtgtgcctagtacgctcacacgagacaatgtctcgtta
acagcggaggattttatgctgtggaatgtgcaatgcggcctaaggctgatgcaacccctg
ctggaccttatttttgagctgtgccacatagtgtttggcctgtggccgcaatgcaagcac
atggagtttgatattgtgcgcggctggttgcagcgcgaggagcgacgtccctaccgagtt
ggccagttctggtatctaatttctcgtgactggtggctcacctggatgcagtatacgcaa
cacacctcgcatacctgcgactactgcaagcgcaccgccagccagcgcagtgcggtcgat
gaagcgctcgtctgtgatgagagcttcaacacgcacagcctggagcagcacgatagctat
tcactgggctccgtgtctggcagcagcggcatctctgctggccgccactgcggccaacag
cgtccgggtcctattgacaatagcaatctaattaccaccaatccctatcgcaatgttcgc
actcttaccggtgagggcggccatctgaagcgtgatacgccacttgtacaaaatcacgac
tttgagctggtgcccaaatcgctgtggaaagcggtgaatcgttggtatggcgacaatctt
cctctgccacgacaggtgatacaaccgccaaactcggaggtggagctggagctgtatccg
ctcaacctgcgcatactgctgcatcaggtgcagacgcccacgatcagtggagccaacaca
caaatcaccaactggggctcaacagtcagcggtggatatggcgttctggcctcgggcggc
ggctatgcggccattgcggccagcagtgtactgcaaccgcccaagcgttatttggcgtac
acggctgcgtttagccggctggccacagtacggcaggtgggagagtttctgtgcgagcaa
ctgcgccttaagccggaggatatacgtctttggcatgtgccgccgtcgagcgcaacgcta
gataatagtgccatactgttggaggaggataccatgtgcctaaaggagctgctgatacgc
gacaacgatcagttgctgctagagatacgcaacaaagatcttacttggcccgaggagctc
agctcgctggccagcacgcaaagcggtcaagctggtgccggtcctggtgataggcgccgt
ctaacgcgcacctccatcatgtccgtgcacgcacctggcgccactggtctacataatctg
ggcaacacctgtttcatgaacgcggcactccaagtgctcttcaatacgcaaccactggcg
cagtactttcatcgtcagatgcatcgcttcgaattgaatgcggccaataagctcggcaca
cgcggtcagcttgccatgcgctatgcggagctgctcaaggaggtgtggacggccacgaca
cgctccgtggcgccgcttaagctgcgcttctgtgtaaacaagcatgcgccgcagtttgcc
ggcggtggacagcacgattcgcaggagctgcttgaatggctgctcgacgcactgcacgag
gacctcaatcgtgtgatggaaaagccctatagcgaactcaaggactcgaatgggcgaccc
gacaagattgttgccgccgaagcctggtcccagcatcatgcacgcaatcaatcaattatc
atagatctgttctatggccagcttaagtcgaaggtcagttgcctgtgctgtgggcacgag
tctgtgcgtttcgatccattcagtttgctcagcctgccgctgccagtggagaactatgtg
tatctggaggtgctggtcattctattggatggcagtgtgccaattaaatatggtgtgcgt
ctaaattcggaatgcaaatacggggatttgaagcataagctggcgacgctgtgtcccctg
cagccaagcctgatgctggtgtgtgagctgtggaattcgcaaatacgccaggtgctcgcc
gatgaggagaagctgcgcacgcaaagttccaaggaactgtatgtgtaccagctgcccgag
cagagcaatgccagaacgcgctcaaattcggcactcagcatgcacatcgagcagggcctg
aaggacatacagcgcagctctgcgctcatcacgacacaggactcactttcatcgcttagc
acactccagacctcaaatcgtacatcctcgtcgcgtgtgatctgcaatggccatctcagt
gatgggcaggacgcggctggcatcgatggagaccatgagctaaccaaatacaaaaacaac
aacattggcggcagcgttggccaagtgcacgaactgcagccagatgatgccggaaaggag
tcgctgattctgagctgcagcccggagaacaactttatggacgatgcggctgcacagcag
aagcgcatctcatccacgaagctgctgcacacggagagcaacactagctcggcatcgtat
acgaatcactctggcgagaactcaatggagagttcgctaacggagccaatgccggtcgcg
gagctggcggtcagtcgacatggcagcaacagtgacgatggcgcctcctatcgcaacacc
aatgagcactccagcgtcaggagcgcagctcacacattggccgtcaatagctttgatcgt
gacgtggaaactgatgcgaacgaagacgacgacgacgacgacgacgttggacaggacgaa
ggcgaggagccggatcaacaaataaccacctcacagccggagagcacgagcggcaatcaa
actagcagcggtgtctattcgcgccgctcctcgcagccctacaaggtgggcaaatatctg
gtggctgtacatcgtaaaatcacgcgccacgacagctacttcctttcctatcacaaaaca
cggcccagcctgtttggtgtgccactgctgatacccaactgtgatggtggcacccacaag
gatctgtattgcgccgtctggctgcaagttaatcggctgctgagtcctctgccagccacc
accgaacaggctaaccatgctgccgactgtgacgacagcctgggctatgattttcccttc
acgctgcgtgcagtcaaagcggacggccttacctgcgccatttgtccgtggtcgagcttt
tgtcgcggctgcgaaattcgctgcaacaatgattatgtgctccagggcgctctgccaccc
atcagctgtgtggccaataacatagccacgccaaaaatgaacgaaaaatgcccatcgcta
ccgaatctggaggccaaaagagcaccggagtacaccacatcgctatcctatactccaaca
acaaaatattttgaagactttaccattgccatcgattgggacccaaccgcattgcattta
cgttatcaaagcaccttggagcgtctctgggtggatcatgagaccattgccatatgccga
cgggagcaagtggagcccgttgatctgaatcattgcctgcgcgcctttacctccgaggaa
aagttggagcagtggtatcactgtagccactgcaagggcaagaagccagcgacgaagaag
ctgcaaatatggaaattgcccccaattctgatcgtccatttgaagcgtttcaattgcgtc
aacggcaaatgggttaaatcgcagaaggtggtgcactttcccttcgatgactttgatcca
acgccttatttggcatcagtgccacaagagacgatactgcggcacaaggagctattagag
ctgaagcgggatttgattggtaacagcaatgaagttcctagcgaactggatgaagtagat
gccagcgacaaagcagatgcggtcccttctgcagatgctccacctccaacagaatcggca
gtaggcgaaaaagtggctactgcaaaggaaacgccgccgaccgctggaagcgtgctgcgt
caaagcaaatcgagcaatgcagccaggcgacagcgcctcatatccacgagccttacaaag
acgcctattgtggatggggaatttgaggactatcatcagcacaagctccaagcgggtgtt
gacgagttcgatcccaaatacaaactgtatgccgtggtgtcgcactctggcatgctgaat
ggtggtcattacatttcctatgcatcaaatacgactggttcctggtattgttacaatgac
agctcctgtcgcgagatatcgcaaaagccaaacattgatccgagcgctgcctatttgctt
ttctatgagcgccagggtctcgactatgaaccctacctgcctaacatcgagggacgtgcg
ctgccaaatgccgccaacctccagctggatgtggacgagtcggagagcgagcttaagaaa
ttatgcacaatatcataa

DBGET integrated database retrieval system