KEGG   Drosophila virilis: Dvir_GJ11383Help
Entry
Dvir_GJ11383      CDS       T01066                                 

Definition
GJ11383 gene product from transcript GJ11383-RA
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.4.19.12]
Organism
dvi  Drosophila virilis
Brite
Enzymes [BR:dvi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dvir_GJ11383
Peptidases [BR:dvi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dvir_GJ11383
Transcription machinery [BR:dvi03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     Dvir_GJ11383
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 704 aa AA seqDB search
MHVIKVAKIRRKQRKCDKTNVPQPSAKRTKTKENSVDSTTSILSSGSGSSSGAGSRASSS
NNNNKRAYASVGRGAADVVPEPRIPPQAASTNPRTAAAAAAAAATTTTTATTTTTTKAAA
GRCPADETVASGGRGGGGSVEGAQLTKGPLNATHLSVPVYLRTVQKLASELDGNANANAS
VNVNVSSSSGSGSSSTSSAVDVDVNVMSETGCRHYQTYVKEHSYDTFRVIDAYFAACVNK
DARLKKAIHCNCFECGSYGIQLYACLHCIYFGCRGAHITSHLRAKKHNIALELSHGTLYC
YACRDFIYDARSREYALINRKLEAKDLQKSLGWQPWIPTPKETNLLLANARRRLVRPNQT
IGLRGLLNLGATCFMNCIVQALVHTPLLSDYFMSDRHDCGSKATHKCLVCEVSRLFQEFY
SGSRSPLSLHRLLHLIWNHAKHLAGYEQQDAHEFFIATLDVLHRHCVKAKSEHESKSNSS
SASGGNSSSGGNATATHCYGQCNCIIDQIFTGMLQSDVVCQACNGVSTTFDPFWDISLDL
GETTTHGGVTPKTLIDCLERYTRAEHLGSAAKIKCSTCKSYQESTKQFSLRTLPSVVSFH
LKRFEHSALIDRKISSFIQFPVEFDMTPFMSEKNNAYGDFRFSLYAVVNHVGTIDTGHYT
AYVRHQKDTWVKCDDHVITMASLKQVLDSEGYLLFYHKNVLEYE
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgcatgtcataaaagtggccaaaattcggcgaaaacagcgcaagtgtgataaaaccaac
gtgccacagccgtctgcaaaacgaacgaaaacaaaagagaatagcgttgatagtacaaca
agcattttaagcagtggcagtggcagcagcagcggcgccggcagcagagccagcagcagc
aacaacaacaacaagcgcgcatacgcctcggtcggccggggagcggccgacgttgtacct
gaaccccgtatacccccacaagcagcgtccacaaacccacgaacagcagcagcagcagca
gcagctgcagcaacaacaactacaacagcaacaacaacaacaacaacaaaggcagctgcc
ggccggtgtccggccgacgaaactgttgctagtggtgggcggggcggcgggggtagtgtc
gaaggcgcacagctaacaaagggtccactgaatgcgacgcatttgtcagttcccgtttat
ttgcgcactgtgcaaaagcttgcatccgagcttgacggaaacgcaaacgccaacgctagc
gtcaacgtcaacgtcagcagtagcagcggcagcggcagcagcagcaccagcagcgccgtt
gacgtcgacgtcaacgtcatgtcggaaacgggctgccggcattatcagacctacgtgaag
gagcacagctacgatacctttcgggtcatcgatgcctactttgccgcctgtgtcaacaag
gatgcgcgtttgaaaaaggccatacactgcaattgcttcgagtgcggcagctatggcatc
cagctgtacgcctgcctgcactgcatctactttggctgccgcggtgcgcacataactagc
cacctgcgcgccaagaagcacaacatcgcactggagctgtcccatggcacattgtactgt
tatgcgtgccgggactttatctatgatgcgcgcagtcgcgagtacgcgctgatcaatcgc
aagctggaggccaaggatctgcagaagagcctcggctggcagccctggatacccacgccc
aaggagaccaatctactgctggccaatgcacgacgtcgtctggtgcgacccaatcaaacg
attggtttgcgtggactgctcaatctgggtgcgacatgcttcatgaactgcattgtccag
gctctggtgcacactccgctgctgagcgactatttcatgtcggatcgccacgactgtggc
agcaaggccacacacaagtgcttggtgtgcgaggtgtcgcgtctgttccaggagttctat
tcgggctcacgttcgccattgtcgctgcatcgcctgctgcatttaatttggaatcatgca
aagcatttggccggctacgagcagcaggatgcgcacgagttttttatagcgacgctggac
gtgctgcatcggcattgcgtgaaggccaagtcggagcacgagagcaagagcaacagctcg
agcgcatcgggcggcaattccagctcaggtggcaatgcaacggccacgcattgctatggc
cagtgcaactgcatcatcgatcaaatctttacgggcatgctgcagagcgatgtggtgtgc
caggcatgcaacggcgtttcgaccacattcgatcccttctgggatatctcactggatctc
ggcgagacaaccacgcacggcggcgtcacgccaaagacgctgattgactgcctggagcgc
tatacgcgagccgagcatctcggttcggcggccaaaatcaaatgctccacctgcaaatcg
tatcaagagtccaccaaacagtttagcctgcgcaccctgcccagcgtcgtttcgttccat
ctgaagcgtttcgagcattcggctctgattgaccgcaaaatatcgtcgttcattcagttt
cccgtcgagttcgatatgacgcccttcatgtccgagaaaaacaatgcctatggcgacttt
cgtttctctctgtacgcggtcgtcaatcatgtgggcaccattgacaccggccactatacg
gcctatgtgcgtcaccagaaggacacgtgggtcaagtgcgatgatcatgtgataacaatg
gcttcgctcaaacaggtgctcgacagcgagggttatttattattctatcataagaatgtt
ctggaatacgagtga

DBGET integrated database retrieval system