KEGG   Drosophila virilis: Dvir_GJ11427Help
Entry
Dvir_GJ11427      CDS       T01066                                 

Definition
GJ11427 gene product from transcript GJ11427-RA
Orthology
K02223  
circadian locomoter output cycles kaput protein [EC:2.3.1.48]
Organism
dvi  Drosophila virilis
Pathway
Circadian rhythm - fly
Class
Organismal Systems; Environmental adaptation; Circadian rhythm - fly [PATH:dvi04711]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 988 aa AA seqDB search
MDDESDDKDDTKRRSRNLSEKKRRDQFNSLVNDLSGLITTSNRKMDKSTVLKSTISFLRH
HNEATDRSKVFEIEQEWKPTFLTNDEFSHLMLESLDAFMVVFNSVGSVFYASESVASQLG
YMPCELYSKNFYDVTYELDQEALLNVFLNPAPVVEPHQTDIGASNQITFYTHLKRGGHEN
RDASLYELVKFVGYFRIDDNSNANASPDSQQTLPRILQQHPGVELDKRLVFVGTGRIQTP
QMIREMSIVEPNGTEFTSKHSMEWKFLFLDHRAPPIIGYMPFEVLGTSGYDYYHFDDLDN
IVACHEELRQTGEGKSCYYRFLTKGQQYIWLQTDYYVSYHQYSSKPDYVVCTHKVISYTD
MLNGDSGEQHTPSQAPKSNSSSSKCASATTTLRDMELSSQHLDSHLLDNMLANLNSEQTA
AAASPTMDSSPMWSSSVAPAASSSTLNPLKTSRPASSYGNISSTGISPKAKRKCYFNYNS
RGNESDSTSMSTDSVTSRQSLMTHCSSQSHRQRSHLHHNQRHHSQQQQQHSNFHQQQQQQ
QQQQQQLQLHQSIGQPKILPMLPLAPAQLVTGSACQLTQSSYPLSTPQLMTPSFLEPPQY
LAAIPVQPVMGPFPVAPVLSPLPVPVSVPVSVQGQQPELLSGAVVMTTTQSQLQDQLQRK
HDELQKLIMQQQDELRIVSEQLLLARYTYLQPVMPVSFATTNMTAAGTPVQRNLTFRGSN
AVEPQFNQYGFALNTEQMLNQQDQQMLMRQQQNLHSQQQHNHNLQQQQQLQQQLQLQQTH
QHQQQQHRQQLQLQHSLQQQQQQQQLQQQQQLQQQQLQLQHQSSMLSREDMEDIDAFLNL
SPLQTLDTQLNSNCNGSNNNSNAPQNTNEDSLLSYMQLATESSPSLNFPMGMSDDGSETH
SEDNQMMHSTAHQQHLLQQQQQQQQQQQQQLLQPQQTSSFFATNPFQSISGNENQSHLPN
DLEILPYQMSQEQSQNLFDSPHAAGKTQ
NT seq 2967 nt NT seq  +upstreamnt  +downstreamnt
atggacgacgagagcgatgacaaggatgacacaaaaagaagatctcgaaatctaagcgaa
aagaagcgtcgggatcaatttaattcgctggttaacgatttgagtggactgataaccaca
tcgaatcgcaaaatggacaagtcaacagtgctgaagtccaccatatcattcctaaggcat
cacaatgaggcaacggatcgctccaaggtcttcgagattgagcaggaatggaagcccaca
tttctgacaaacgatgagttttctcatttgatgctcgagtccttggatgccttcatggtg
gtctttaacagcgtgggctccgtattctatgcatcggagagtgtggcctcacagctcggc
tacatgccgtgtgagttgtacagcaagaacttttacgatgtgacctatgagctggatcag
gaggcactgctgaacgtctttctgaatccagcgcccgtcgtcgaaccacatcagacggac
attggtgccagcaaccagattaccttctacacgcatctgaaacgcggcgggcacgagaat
agggatgcgagtctgtacgagctggtgaaattcgtgggttactttcgaatcgatgacaac
agcaatgcgaacgccagcccggacagccagcagacgctgccgcgcatcctgcaacagcat
ccgggcgtggagctggacaagcggctggtttttgtgggcacgggccgcatacagacgccg
cagatgatacgcgagatgagcatcgtggagccgaacggcaccgagttcacctcgaagcac
agcatggagtggaagtttctgttcctcgaccatcgagcgccgcctatcattggctatatg
ccgttcgaggtgctgggcacctccggctatgattactatcacttcgatgatctggacaac
attgtcgcctgccacgaggagttgcgccagacgggcgagggcaagtcctgctattatcgc
tttctgaccaagggccagcagtacatttggctgcagacggactactacgtgagctatcac
cagtacagctccaagccggactacgtggtctgcacgcacaaggtgatcagctatacggat
atgctgaatggggatagcggggagcagcatacgcctagccaggcgcccaagtccaactcg
agcagcagcaagtgcgcctcggcgacgaccacgctgcgtgacatggagctgagcagccag
catctggacagccatctgctagacaatatgctggccaatctgaacagtgaacagacagct
gcagccgcctcgcccacgatggactcctcgcccatgtggtcgtcgagcgtggcgccagcc
gcaagcagctccaccttgaatcccttaaagacctccagacccgcctctagctatggcaac
atcagctccacgggcatctcgccgaaggccaagcgcaaatgttacttcaactacaacagc
cgtggcaacgaatccgactcgacatccatgtccacggattcagttaccagcaggcaatcc
ctcatgacgcattgcagctcgcaaagtcatcgtcagcgctcgcatctgcatcacaaccag
cggcatcattcgcagcagcagcagcaacactcaaacttccatcagcagcagcaacagcag
cagcagcagcaacaacagttgcagctgcatcagagcatcgggcagccgaagatattgcca
atgttgccgctggcgccagcgcaactcgttacgggcagcgcctgccagctgacacagtcc
agctacccgttgagcacaccgcagctgatgacgcccagttttctcgagccgccacaatat
ctggccgccatacccgtgcagccggtgatggggccgtttccggtggcgcccgtgctgtcg
ccgttgccagtgccggtatcggtgccggtgtcggtgcaggggcagcaaccggagctgctg
tcgggcgccgtggtgatgaccacgacacagagccagctgcaggatcagctgcagcgcaag
catgacgagctgcagaagctgatcatgcagcagcaggacgagctgcgcatcgtctccgag
caactgttgctcgcgcgctacacgtacctgcagcccgtgatgcccgtcagctttgccact
accaacatgacagctgccggcactcctgtgcagcgcaacttaactttccggggcagcaat
gccgtggagccgcagttcaatcagtacggcttcgcgctcaacacggagcagatgctcaat
cagcaggaccagcagatgctgatgcgccagcagcagaatctgcacagtcagcagcagcac
aatcacaatctgcagcagcagcagcagctacagcaacagctgcagctgcaacagacccac
cagcatcagcagcagcagcaccggcagcaactgcagctgcaacacagcctgcaacagcag
cagcagcagcaacagttgcagcaacagcagcagttgcagcagcaacagttgcagctgcag
catcagagcagcatgttgtcgcgtgaggacatggaggacattgatgcctttctcaatctg
tcgccgctgcagacgctcgacacgcagctaaacagcaactgcaacggcagcaacaacaac
tcgaatgcgccgcagaatacgaatgaggactcgctgctctcgtacatgcaactggccacc
gaatcgagtccttcgctcaactttcccatgggcatgagcgatgacggctccgagacgcac
agcgaggacaaccagatgatgcacagcaccgcgcatcagcaacatctactgcagcaacag
caacagcagcagcagcagcagcaacagcaactgttgcagccgcagcagacgagcagcttt
ttcgccacgaatcctttccagtcgatcagtggcaatgagaaccagagccatctgcccaac
gatctggagatattgccatatcaaatgtcgcaggagcaatcgcagaatctgttcgattcg
ccgcacgcggctggcaaaactcaatag

DBGET integrated database retrieval system