KEGG   Drosophila virilis: Dvir_GJ11432Help
Entry
Dvir_GJ11432      CDS       T01066                                 

Definition
GJ11432 gene product from transcript GJ11432-RA
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
dvi  Drosophila virilis
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dvir_GJ11432
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dvir_GJ11432
   00620 Pyruvate metabolism
    Dvir_GJ11432
   00640 Propanoate metabolism
    Dvir_GJ11432
Enzymes [BR:dvi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Dvir_GJ11432
Lipid biosynthesis proteins [BR:dvi01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Dvir_GJ11432
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 670 aa AA seqDB search
MPTEKSIFNPNPAISRNAYISSFDEYKKFYQESLDNPTEFWSRVAKQFHWETPADPSKFM
QYNFNISKGPVSIKWMEGASTNICYNLLDRNVRNGLGDQIAFYWEGNHPDDYSRGLTYRK
LLEEVCRFANVLKDHGIKKGDRVSIYMPMILELPIAMLACSRIGAVHSIVFAGFSPDSLA
ERMFDCKAKLLITADGAWRGEKPLYLKALCDTALEKVDEMGHSVEKCIVVSHLKRVTPCQ
ENHVEQDIPWTDDRDYWWHEEMEDKEPACYPEWMDAEDPLFMLYTSGSTGKPKGVLHTTA
GYLLYAATTFKIVFDYHPGDIYWCTADVGWITGHTYVVYGPLANGATSVIFEGTPFYPGN
DRYWSVIDKYKVTQFYTAPTAIRALMKFGEAPVLKHNLSGLKVLGSVGEPINPEAWLWYY
RNIGKEQCSIVDTFWQTETGGHVITPLPGATPMKPGSATFPFFGVKPLLLDECGIEIKGE
GEGYLVFSQPWPGMMRTLYNNHERFEDTYFSKFPGYYCTGDGARRDADGYLWITGRVDDM
LNVSGHLMSTAEVESVLTEHPRVAESAVVSRPHPVKGECLYCFITPNENEAFDQKLIADL
KKMVRERIGPFAMPDVIQNAPGLPKTRSGKIMRRVLRKIAVNDRNVGDTSTLADEQIVEQ
LFANRPVEAK
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atgccaactgaaaaatcaatattcaatccaaatccggcaatcagccgcaatgcctacata
tccagcttcgatgagtacaagaaattctatcaggagtccttggacaatccgaccgagttt
tggtcgcgcgttgcgaaacaatttcactgggaaacgccagcggatccctcaaaattcatg
caatacaatttcaacatctccaaaggacccgtttcgatcaaatggatggagggcgcctcg
accaacatatgctacaaccttctcgatcgaaatgtacgcaacggcctgggcgatcagata
gcgttctactgggagggcaaccaccccgatgactattcgcgcggtctcacctatcgcaag
ctgctggaggaggtctgccggttcgccaacgtgctaaaggatcatggcatcaagaagggc
gatcgcgtctcgatctatatgcccatgatcctggagctgcccattgccatgctggcctgc
tcacgcattggcgccgtgcactcgattgtctttgcgggcttctcgccggattctctggcg
gagcgcatgttcgattgcaaggccaagctgctgattacggccgatggcgcttggcgtggc
gagaagccgctctacctgaaagccctgtgcgacacggccctggagaaggtcgacgagatg
ggtcactccgtggagaaatgcattgtggtgtcacatctgaagcgcgttacgccctgccag
gagaatcatgtggagcaggatataccgtggaccgatgatcgcgactactggtggcacgag
gagatggaggacaaggagccggcctgctatcccgaatggatggacgccgaggatccattg
tttatgctctacacgagcggctccacgggcaagcccaagggcgtgctccacaccacggcc
ggctacctgctctatgcggccaccacattcaagattgtgtttgactaccatcccggtgac
atctactggtgcaccgccgatgtcggctggatcactggacacacctatgtggtctacggt
ccattggccaacggcgccacttcagttattttcgagggcacgcccttctatcccggcaac
gatcgctactggagcgtcattgacaagtacaaggtcacccagttctatacggcgcccacg
gctatacgtgcgctcatgaagtttggcgaggcgccggtgctcaagcacaatctgagcggt
ctcaaggttttaggcagcgttggtgagcccattaatccggaggcctggctctggtactat
cgcaacattggcaaggagcagtgctccattgtggacacgttttggcaaacggaaactggc
ggtcatgtcataacgcctctgcccggcgccacgcccatgaaaccaggctctgctacgttt
cccttctttggcgtcaagcctttgctgctggatgagtgcggaattgagatcaagggcgag
ggcgagggctacctggtgttctcgcagccctggccgggcatgatgcgcacgctgtacaac
aatcatgagcgcttcgaggacacatacttctccaagtttcccggctactattgcactgga
gacggagctcgtcgcgatgctgatgggtatttgtggatcactggccgcgtggatgatatg
ttgaatgtgtcgggtcatctgatgtccaccgccgaggtggagtctgtgctcacggagcat
ccacgtgtcgccgaatcggctgtggtatcccggccgcatccggtcaagggcgaatgtctc
tattgcttcataacgcccaatgagaatgaggcgttcgaccagaagctaatcgccgacctt
aagaagatggtgcgcgaacgcattggccccttcgccatgccagatgttatacaaaatgcg
cccggcttgcccaagacgcgctccggcaagataatgcgtcgggtgttgcgcaagattgcc
gtcaacgatcgaaatgtgggcgacacctccacgctggccgatgagcagattgtggagcag
ctgttcgccaatcgtcccgtggaggccaagtaa

DBGET integrated database retrieval system