KEGG   Drosophila virilis: Dvir_GJ11446Help
Entry
Dvir_GJ11446      CDS       T01066                                 

Definition
GJ11446 gene product from transcript GJ11446-RA
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
dvi  Drosophila virilis
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    Dvir_GJ11446
  Replication and repair
   03420 Nucleotide excision repair
    Dvir_GJ11446
Transcription machinery [BR:dvi03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     Dvir_GJ11446
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 492 aa AA seqDB search
MADTKSGRYASSSAAISPLVQSPENLECKNFQEYLRTRQTPETLEKLYNYPPICLAVYRE
LPEIARQFVIRILFIDQPVPQAVVTSWGAQRVAKEQMEATSCLTALCVWRVTAIPGGLAA
WELSPTFKKSVRQVLLGGGKPWAMTNTLDRDSKPRDIAFLDSYAMSRWRCVLHYMVGTGS
RGGTDAEAISPDAVRILLHANLMKRDERDGITITRQGFQFLLLDTRAQVWHFMLQYLETC
EERGICLPECLSMLFQLSFSTLGRDYSSEGMNNQMLTFLQHLREFGLVFQRKRKEGRFYP
TRLALNVTNKDAAQASTSADEERMQERGYIVVETNYRVYAYTDSQLQVAVLGLFTELLYR
FPNLVVGVLTRDSVRQALRGGITAEQIVSYLEQYAHPNMKLVESAIQSKSCLPPTIVDQI
KLWEMERNRFTYTEGVVYNQFLSQNDFVTLRDYAQSINMLVWQNERTRTMVVQKNGHDDV
KRYWKKYSKSGG
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggccgatacaaaatccggccgttatgcgagcagcagcgctgctatatcccccctagta
cagagtccagagaatttggagtgcaagaactttcaggaatatctgcgcacccgccaaaca
cccgagacgctagagaagctctacaattatccacccatttgcctggcggtctatcgcgag
ttgcccgaaatcgcaagacagtttgtaattcgcatactgttcatagatcagccagtgcca
caagccgttgtcacctcatggggtgcacaacgcgttgccaaggaacaaatggaggccacc
agctgcctgactgctttgtgtgtttggcgcgtcacggccataccaggcggcctggctgct
tgggagctgtcaccaacgtttaagaagagcgttcgtcaggtgctactgggcggtggcaag
ccctgggcaatgaccaatacactagatagggactccaagccgcgtgacattgcgtttctg
gactcgtatgccatgtcccgctggcgctgtgtgctgcactatatggtgggcacgggcagc
cgtggcggcaccgatgccgaggcaatcagtccagatgcggtgcgcattctgctacatgcg
aatcttatgaagcgcgacgagcgcgatggtatcaccattacacgtcagggatttcagttt
ttgttgctagacacgcgcgctcaggtctggcattttatgctccagtatttggagacatgc
gaggagcgcggcatctgtctgcctgagtgcctgtccatgctgtttcagttgagtttctcg
acgcttggacgcgactacagctcagagggcatgaacaatcagatgttgacgtttttgcag
catctacgtgagtttgggctggtgtttcaacggaaacgcaaggagggtcgcttttatccc
acacgactggcgctgaatgtaacgaacaaggatgcagcacaggcttcaacatcggcggat
gaggagcgcatgcaggagaggggttacatcgtggtggaaaccaattaccgcgtttatgcc
tacacagattcacagctgcaggtggctgtactcggtctttttaccgagctgctctatcgc
tttcccaatctcgttgtgggtgtcctcacacgcgactctgtgcgccaagcactgcgaggc
ggcattacggccgagcaaatcgtcagttatttggaacagtatgcacatcccaacatgaaa
ctggtcgaatcagccattcaatcgaagtcctgcctgccgcccacaattgtagatcaaatc
aaactctgggaaatggaacgcaatcgtttcacatacacagagggcgttgtttacaatcag
ttcctgtcacaaaacgactttgtaacgctgcgcgactacgcccaatccataaacatgctg
gtgtggcagaatgaacgcacccgcaccatggtggtacagaagaacggtcacgacgatgtc
aagcgctactggaagaagtactcaaaaagcggcggctag

DBGET integrated database retrieval system