KEGG   Drosophila virilis: Dvir_GJ11510Help
Entry
Dvir_GJ11510      CDS       T01066                                 

Definition
GJ11510 gene product from transcript GJ11510-RA
Orthology
K01059  
lipoprotein lipase [EC:3.1.1.34]
Organism
dvi  Drosophila virilis
Pathway
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Dvir_GJ11510
Enzymes [BR:dvi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.34  lipoprotein lipase
     Dvir_GJ11510
Exosome [BR:dvi04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   Dvir_GJ11510
  Exosomal proteins of breast milk
   Dvir_GJ11510
Heparan sulfate/heparin binding proteins [BR:dvi00536]
 Enzymes (General comment) Variety
  Dvir_GJ11510
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 385 aa AA seqDB search
MRPQFNGLRALSIILLSTGYTAEANNSTSSWWQGIPNAFTDILTLKLNIFTAFPLELAAS
VIDTLCSSTLFIGSVPPQIQPDITKMHFQYMTPCLNYSVPLLKAEKLWNHPKFRQNHKLV
ILATGWTNTVNDSATISMISRAFMCRPAVNFVIVDAAYYVDTLYKWSALNTDLIGEHLAV
GLQHLIKVMPLMDIHLIGHSLGAHIMGTAGRTFKKLTGRLVSRITGLDPAKPCFRNEKSL
PGLMRGDAALVDVIHTNIGILAKRDPLGDIDFYPGGAHPIKPGCLTIGCSHTRAVEYFAE
SVYPQQERNFLGFKCRSWKELERRKCQTDKTSTMGYMINRKATGIFYVDVNGQSPYGKNF
NPLKRKHVDCAKPKCRSKLSSKVQS
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgcgtccccaattcaatggcctaagagctctaagcataattcttctcagcacagggtat
actgcagaggctaacaactcaacgagtagctggtggcagggaattcccaatgcctttacg
gatattcttaccttgaaattgaatatttttacagcatttccgctggaattggcagcatcc
gttattgataccttgtgctcctccacgctgtttattggaagcgtgcctccgcaaatacag
ccggacataacgaaaatgcactttcagtatatgacgccatgcctgaattatagcgttccg
ttattgaaagccgaaaagttatggaatcatccgaaatttcgacagaatcataaattggtc
atcctggctacgggctggacaaataccgttaacgattctgccaccatatcgatgatatcg
agggcttttatgtgtcggcctgctgttaattttgtgattgtagatgcggcctattacgtg
gacacattgtacaagtggtcggccctgaacacagatctcattggggagcacctagccgtc
ggtttacagcatttgataaaggtgatgccattgatggacattcatttgattggtcattca
ttgggcgcccatattatgggcactgctggtcgcacattcaaaaaactaacgggacgtctt
gtgtctcgtataactggtctggatccagccaagccctgttttcgcaatgaaaaatcactg
cccggactgatgcgtggcgatgctgcgctagtggacgttatacacacaaatattggcatt
ttggcgaaacgagatccgttgggcgacattgacttttatcctggaggtgcacatcccatt
aagcccggctgcctgactattggctgctcacacacgcgtgctgttgagtattttgcggag
agcgtctatccgcaacaggagagaaatttcctgggtttcaaatgcaggtcgtggaaagag
ctcgaaaggcgaaaatgtcagaccgacaaaacttcaacaatgggctatatgattaaccgg
aaggcgactggcattttttacgttgatgttaatggccaaagcccgtatggcaaaaacttc
aatccgttgaaacgaaaacatgttgactgcgccaagcccaagtgcagatctaagttatcc
agtaaagttcagtcttaa

DBGET integrated database retrieval system