KEGG   Drosophila virilis: Dvir_GJ11510Help
Entry
Dvir_GJ11510      CDS       T01066                                 

Definition
(RefSeq) uncharacterized protein
Organism
dvi  Drosophila virilis
SSDB OrthologParalogGFIT
Motif
Pfam: Lipase Spo7_2_N
Motif
Other DBs
NCBI-GeneID: 6622280
NCBI-ProteinID: XP_002048135
FlyBase: FBgn0198768
UniProt: B4LGE8
Position
Unknown
AA seq 385 aa AA seqDB search
MRPQFNGLRALSIILLSTGYTAEANNSTSSWWQGIPNAFTDILTLKLNIFTAFPLELAAS
VIDTLCSSTLFIGSVPPQIQPDITKMHFQYMTPCLNYSVPLLKAEKLWNHPKFRQNHKLV
ILATGWTNTVNDSATISMISRAFMCRPAVNFVIVDAAYYVDTLYKWSALNTDLIGEHLAV
GLQHLIKVMPLMDIHLIGHSLGAHIMGTAGRTFKKLTGRLVSRITGLDPAKPCFRNEKSL
PGLMRGDAALVDVIHTNIGILAKRDPLGDIDFYPGGAHPIKPGCLTIGCSHTRAVEYFAE
SVYPQQERNFLGFKCRSWKELERRKCQTDKTSTMGYMINRKATGIFYVDVNGQSPYGKNF
NPLKRKHVDCAKPKCRSKLSSKVQS
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgcgtccccaattcaatggcctaagagctctaagcataattcttctcagcacagggtat
actgcagaggctaacaactcaacgagtagctggtggcagggaattcccaatgcctttacg
gatattcttaccttgaaattgaatatttttacagcatttccgctggaattggcagcatcc
gttattgataccttgtgctcctccacgctgtttattggaagcgtgcctccgcaaatacag
ccggacataacgaaaatgcactttcagtatatgacgccatgcctgaattatagcgttccg
ttattgaaagccgaaaagttatggaatcatccgaaatttcgacagaatcataaattggtc
atcctggctacgggctggacaaataccgttaacgattctgccaccatatcgatgatatcg
agggcttttatgtgtcggcctgctgttaattttgtgattgtagatgcggcctattacgtg
gacacattgtacaagtggtcggccctgaacacagatctcattggggagcacctagccgtc
ggtttacagcatttgataaaggtgatgccattgatggacattcatttgattggtcattca
ttgggcgcccatattatgggcactgctggtcgcacattcaaaaaactaacgggacgtctt
gtgtctcgtataactggtctggatccagccaagccctgttttcgcaatgaaaaatcactg
cccggactgatgcgtggcgatgctgcgctagtggacgttatacacacaaatattggcatt
ttggcgaaacgagatccgttgggcgacattgacttttatcctggaggtgcacatcccatt
aagcccggctgcctgactattggctgctcacacacgcgtgctgttgagtattttgcggag
agcgtctatccgcaacaggagagaaatttcctgggtttcaaatgcaggtcgtggaaagag
ctcgaaaggcgaaaatgtcagaccgacaaaacttcaacaatgggctatatgattaaccgg
aaggcgactggcattttttacgttgatgttaatggccaaagcccgtatggcaaaaacttc
aatccgttgaaacgaaaacatgttgactgcgccaagcccaagtgcagatctaagttatcc
agtaaagttcagtcttaa

DBGET integrated database retrieval system