KEGG   Drosophila virilis: Dvir_GJ11750Help
Entry
Dvir_GJ11750      CDS       T01066                                 

Definition
(RefSeq) GJ11750 gene product from transcript GJ11750-RA
  KO
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
dvi  Drosophila virilis
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Dvir_GJ11750
Enzymes [BR:dvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     Dvir_GJ11750
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 648 aa AA seqDB search
MSKSQERSTSSAISTPNKAGDDLHNVSDTFYTSQRKGSHVFRVRLDATGFTLQRESPSGV
IIKEQTVKICDIVGARCMRMKKSPRNLGRCACVNPGTPAGAANRKGGTPSKCSPASKEET
GCDVGDGSAYLYLFAYVLKKKSLRSSLHRERTVLTLRFRSFDTFEDNMREADRWYRALRW
QLHQTLEDIFVERTGEARRRRVLVLLNPKSGSGNAREVFNMHVAPVLNEAEVPYDLYATK
HSNYAIEFMSTRRLDDWCTIIAVGGDGLFHEIVNGLLRRADWAQVLDNIALAIIPCGSGN
GLARSIAHGFNEPYFSNPVLGAALTAISGRSSPMDAVRVELQNRVMFSFLSIGWGLISDV
DIESECIRMFGYQRFTIWTLYRLANLRTYNGKISYLLADETQEPQSMLLPQSEQLRKMQS
SRSCNVHIDKLSTASCHRSSEYLPQEFEDVISLETSINQSFRSRCDSWLSGGSRRSCYYS
ISESVYHSLADESEFADLSAAAATGLEQNQHNFGPSSILPSLNEPLPEAAGWLVEEGEFI
MMHAVYQSHLGVDCHFAPKAQLNDGKIFLVLIRGGISRPHLLSFLYNMSTGTHLPEKNNE
YVKVLQVRAFRLEPHDNHGIITVDGEQIEFGPLQAEILPGISRVMVPK
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaatctcaggagaggagtacgagctccgctatctccacacccaacaaggctggc
gacgaccttcacaatgtatcggacaccttctacaccagtcagcgcaaaggaagccacgta
tttcgagtgcgcctggacgccacaggattcaccctgcaacgcgagtcgcccagcggagtc
atcatcaaggagcagacggttaaaatatgtgatatcgttggagcacgctgcatgcgcatg
aagaagtcgccacgcaatctgggcagatgtgcctgcgtcaatcctggtactccagcaggt
gcggccaaccgcaagggcggcacgcccagcaagtgcagccccgccagcaaggaagagact
ggttgcgacgtgggcgatggcagtgcctatttgtatttgtttgcctacgtgctcaaaaag
aaaagcttgcgtagcagcctgcacagggagaggactgtgctcactctgcgctttcgttcc
ttcgatacgtttgaggacaacatgcgtgaggcggatcgctggtatcgcgctctacgctgg
cagctgcatcaaacactggaggacatatttgtggagcgcaccggcgaggctcgtcgtcgc
cgcgtcctggtgctgctcaatcccaaatccggctcgggaaatgcacgcgaggtgttcaac
atgcatgttgcacccgtgctcaacgaggccgaggtaccctatgatctgtatgcaacgaag
cattccaactacgcaatcgaatttatgagcactcgtcgcctggacgactggtgcactata
atagccgttggcggcgatggactttttcacgagatagttaacggactgctgcgccgggca
gattgggcccaagtcctggacaacattgcattggccattattccctgtggctctggcaat
gggctggcacgttccatagcgcacggctttaatgaaccatattttagtaatcctgtactg
ggtgccgctctaaccgccatcagcggccgcagctcgcccatggatgcggtgcgtgtggag
ctacagaatcgtgttatgttttcgtttctttctattggttggggcctcatctcggacgtg
gatatagagagtgagtgcatacgaatgtttggctatcaacgcttcaccatttggacgctg
taccgcctggccaatttgcgcacttacaatgggaaaatcagttatctactagcggatgag
acgcaggagccacagtctatgctgttgccgcaatcggaacagttgcgaaagatgcagtcc
agtcgcagctgcaatgtgcatatcgataagctgtccactgccagctgtcaccgttcttcg
gaatatttgccacaagagttcgaggatgttatctctttggaaacgtccatcaatcagtcg
tttcgctcgcgttgcgacagctggctatccggtggatcgcgtcgcagctgctattattcc
atatcagagagtgtctatcacagtttggccgatgagagcgagtttgcggatctgtcggct
gcagctgcaactggattggagcagaaccagcataacttcggcccaagtagcatcctaccg
tcgctgaacgaaccgttgcccgaagccgccggctggctggtcgaggagggagaatttatc
atgatgcatgccgtttatcagtcacatctcggcgtggattgccactttgcacccaaagcg
caactgaacgatggcaaaatatttttggttttaatacgcggcggcattagccgtccgcat
ctgctcagctttttatataacatgagcaccggcactcacctgcccgagaagaacaatgaa
tatgtgaaggtgctgcaggtgcgtgcgttccgtttggaaccgcacgacaatcacggcatc
atcacagtggatggtgagcagattgagtttggtccactccaggcggaaatactgccaggc
atttcgcgtgtcatggtaccaaaatga

DBGET integrated database retrieval system