KEGG   Drosophila virilis: Dvir_GJ11750Help
Entry
Dvir_GJ11750      CDS       T01066                                 

Definition
GJ11750 gene product from transcript GJ11750-RA
Organism
dvi  Drosophila virilis
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 648 aa AA seqDB search
MSKSQERSTSSAISTPNKAGDDLHNVSDTFYTSQRKGSHVFRVRLDATGFTLQRESPSGV
IIKEQTVKICDIVGARCMRMKKSPRNLGRCACVNPGTPAGAANRKGGTPSKCSPASKEET
GCDVGDGSAYLYLFAYVLKKKSLRSSLHRERTVLTLRFRSFDTFEDNMREADRWYRALRW
QLHQTLEDIFVERTGEARRRRVLVLLNPKSGSGNAREVFNMHVAPVLNEAEVPYDLYATK
HSNYAIEFMSTRRLDDWCTIIAVGGDGLFHEIVNGLLRRADWAQVLDNIALAIIPCGSGN
GLARSIAHGFNEPYFSNPVLGAALTAISGRSSPMDAVRVELQNRVMFSFLSIGWGLISDV
DIESECIRMFGYQRFTIWTLYRLANLRTYNGKISYLLADETQEPQSMLLPQSEQLRKMQS
SRSCNVHIDKLSTASCHRSSEYLPQEFEDVISLETSINQSFRSRCDSWLSGGSRRSCYYS
ISESVYHSLADESEFADLSAAAATGLEQNQHNFGPSSILPSLNEPLPEAAGWLVEEGEFI
MMHAVYQSHLGVDCHFAPKAQLNDGKIFLVLIRGGISRPHLLSFLYNMSTGTHLPEKNNE
YVKVLQVRAFRLEPHDNHGIITVDGEQIEFGPLQAEILPGISRVMVPK
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaatctcaggagaggagtacgagctccgctatctccacacccaacaaggctggc
gacgaccttcacaatgtatcggacaccttctacaccagtcagcgcaaaggaagccacgta
tttcgagtgcgcctggacgccacaggattcaccctgcaacgcgagtcgcccagcggagtc
atcatcaaggagcagacggttaaaatatgtgatatcgttggagcacgctgcatgcgcatg
aagaagtcgccacgcaatctgggcagatgtgcctgcgtcaatcctggtactccagcaggt
gcggccaaccgcaagggcggcacgcccagcaagtgcagccccgccagcaaggaagagact
ggttgcgacgtgggcgatggcagtgcctatttgtatttgtttgcctacgtgctcaaaaag
aaaagcttgcgtagcagcctgcacagggagaggactgtgctcactctgcgctttcgttcc
ttcgatacgtttgaggacaacatgcgtgaggcggatcgctggtatcgcgctctacgctgg
cagctgcatcaaacactggaggacatatttgtggagcgcaccggcgaggctcgtcgtcgc
cgcgtcctggtgctgctcaatcccaaatccggctcgggaaatgcacgcgaggtgttcaac
atgcatgttgcacccgtgctcaacgaggccgaggtaccctatgatctgtatgcaacgaag
cattccaactacgcaatcgaatttatgagcactcgtcgcctggacgactggtgcactata
atagccgttggcggcgatggactttttcacgagatagttaacggactgctgcgccgggca
gattgggcccaagtcctggacaacattgcattggccattattccctgtggctctggcaat
gggctggcacgttccatagcgcacggctttaatgaaccatattttagtaatcctgtactg
ggtgccgctctaaccgccatcagcggccgcagctcgcccatggatgcggtgcgtgtggag
ctacagaatcgtgttatgttttcgtttctttctattggttggggcctcatctcggacgtg
gatatagagagtgagtgcatacgaatgtttggctatcaacgcttcaccatttggacgctg
taccgcctggccaatttgcgcacttacaatgggaaaatcagttatctactagcggatgag
acgcaggagccacagtctatgctgttgccgcaatcggaacagttgcgaaagatgcagtcc
agtcgcagctgcaatgtgcatatcgataagctgtccactgccagctgtcaccgttcttcg
gaatatttgccacaagagttcgaggatgttatctctttggaaacgtccatcaatcagtcg
tttcgctcgcgttgcgacagctggctatccggtggatcgcgtcgcagctgctattattcc
atatcagagagtgtctatcacagtttggccgatgagagcgagtttgcggatctgtcggct
gcagctgcaactggattggagcagaaccagcataacttcggcccaagtagcatcctaccg
tcgctgaacgaaccgttgcccgaagccgccggctggctggtcgaggagggagaatttatc
atgatgcatgccgtttatcagtcacatctcggcgtggattgccactttgcacccaaagcg
caactgaacgatggcaaaatatttttggttttaatacgcggcggcattagccgtccgcat
ctgctcagctttttatataacatgagcaccggcactcacctgcccgagaagaacaatgaa
tatgtgaaggtgctgcaggtgcgtgcgttccgtttggaaccgcacgacaatcacggcatc
atcacagtggatggtgagcagattgagtttggtccactccaggcggaaatactgccaggc
atttcgcgtgtcatggtaccaaaatga

DBGET integrated database retrieval system