KEGG   Drosophila virilis: Dvir_GJ11874Help
Entry
Dvir_GJ11874      CDS       T01066                                 

Definition
GJ11874 gene product from transcript GJ11874-RA
Orthology
K06101  
histone-lysine N-methyltransferase ASH1L [EC:2.1.1.43]
Organism
dvi  Drosophila virilis
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    Dvir_GJ11874
Enzymes [BR:dvi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     Dvir_GJ11874
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 2343 aa AA seqDB search
MSSGQNEASAAAKKEKVLEAQQRTQESGSENEETDSITDQSSQSKSTKSATQFSVQRSDT
DGLRMKISAIRNPPSTTATIENSSRKKLAKVRKMSEAQELSGCSADGKEKHREKEKERDK
MLSTVNTTKKIKVKRKKIAQKSSSSSSNNNNNNSKTLRKPAAAFSSDSEDDLPLKVHMQR
APRLLLTAIGGSQGQGENHMGISSSDNEELVRAADLVKAAIKRVESDAEDNASVAAGVAA
AKIKQQLPQYQSTLLKDFMEKTQRLNQPGHATSLPKAAMQPSAAAAAAAAVNNSSSNNNT
LSQPLQRKRRGRPKKLQPTVATSAPAALPVAVPTINESADSGVISTTPSPKMQQLLISDN
AKPKIDMAYLDKRMYATAERVLYPPPRSKRRQGNKKVNKEELQVDPLWRKIDVNKKFRLR
TVSGYKSDGGGGGGTSNTICSKILAAKSGYVSDYGSVRHQRHNHNSGYKSDASCKSRYSS
RSCASRRMSRAKSCGYRSDCKESSGKSSKSLRRRRRASMLRSGHEQATQALSDEHDQDIL
QLAGLSLGQSSEESNEYISKPSLKCLPSTSASKKYGEINRFVATGQYFSGAAKPTTTSVA
AGANTTTTTTTTAADNFIQGKMLLQRKHSISQDTMLPGKSACKIKSRRSSAASMCSSYVS
GASRVRRRHRRKSFSHAKSLNIDSKLLTEIDIIASTFHARCRIQDDRLTASSGKEKLLAE
ANKLQATLTAPIAATLPLLNGGGGGGSNSTTSAAATTKPLKRALKKRKLNEPLIDFAMLS
ASAGNSNGISNNNSSSSNGAKRRHKKSSSNSGGSNSSSPDDHKLPLKKRHYLVTTGAEVA
SAFASNGKLNAEAWAAAAAAAKSSANTKAQAQFNAKKLTPKKRHLLVSQEVASGAAATAG
SASPLRIVVDNNSISGGKLLDISPSSLCSLKQQRRQGAKAKNLLVASAGAVARELPQQLQ
SPAGSSSCPPPGIFEPSVELEIQIPIAKLNESVITKSEVESPLLAALDIKEDANKKEQCQ
RVLETLLHKTGGNLLLKRKRKKINRTGFPTVRRKKRKVSVEHTLLPQQQQQQQLEQQQQQ
LPARETRSSSTLAAALTMDCERVPKTGEAQETFVARSSNQRTPRLSVVALERLQRPQTPA
NSGGNARGRPRGRGRPKLQKPQPPAPQQQQQQSHPVAQLLEVQPAKKRGRAAKQTELLVP
RLERKLEPSIKLPAGIDPNTNFSCKIRLKRRKTIQQEAVKQLEPAKQPEQQLRLDVSTPL
ATSDDRMQIAAEAAAKRSQQPVPASEHEPLPAQESTLNLATDYGSCSDTSEDKCSTASQR
KRTKLKKNFLVAGLFSNYFKQLPAGAAATVPSTAVAVKQPNRKATDGEQTEQQQPQVSVL
LPPPSYCERYFRRTLNDFELPYDIWWAYSHDKLPTRHVVPSWNYRKIRTNVYAESVRPNL
AGFDHPNCNCKPQASGACLDNCLNRMVYTECAPSNCPAGDKCRNQKIQRHEVAPGVERFM
TADKGWGVRTKLPIAKGTYILEYVGEVVTEREFKQRMASIYLNDTHHYCLHLDGGLVIDG
QRMGSDCRFVNHSCEPNCEMQKWSVNGLSRMVLFAKRAIEQGEELTYDYNFSLFNPSEGQ
PCRCNMPQCRGVIGGKSQRIKPLPAELKTTAGAESAAAGLKEANGNQHGRQRKHKAKKNA
QRLQQAAKEAMVVARVQQLSEREKKLVKQCNIFLVRNFEKIRRCKAKRAAAKAQAAASPA
AGDSDLPGRRPSTPSSSSLLAAQISALCTPRNMKTRGLTQAVQDPELEKMAKMAVVLRDI
CTALESLKMFDLLSTLPSSKKKKQLKTTRLDFKTIQAQVEQGHYKTPQAYDEHMLQLFAE
ARQLHGDDEGKSNALQTLLESYTQQKAANYAQLLDILGKPEALHSFKPKEEEEEKVAELA
TATDQSQENIKPSTKVIASATPETSAAVDVGPELPPTDEEDVIRCICGLYKDEGLMIQCA
KCMVWQHTECTKADIDADNYQCERCEPREVDREIPLDEYTEEGHRYYLSLMRGELQVRQG
DAVYVLRDIPIKDETGKVLPSQKHTYETIGAIDYQECDIFRVEHLWKNEAGKRFIFGHHF
LRPHETFHEPSRRFYPNEVVRVSLYEVVPIELVIGRCWVLDRTTFCKGRPMECNDEDHCY
ICELRVDKTARFFSKAKANHPACTKSYAFRKFPEKLKISKSYAPHDVDPSLLKTRKQKTD
IEVGATPIKMSRHEQKTGQTTGNRKQRNTQAGTATGATASTQVPVQVLTPVAPNGQVLKK
KRSRLENVLNTMKLKCLDAQTAQEQPIDLSYLLSGRGARQRKTNCTSNGGSSSNNNNSAT
PCA
NT seq 7032 nt NT seq  +upstreamnt  +downstreamnt
atgagcagtggccaaaatgaggcatcagcagcagcaaaaaaggaaaaggttctcgaagcg
cagcaacgtacacaagaatccggcagtgaaaatgaggaaaccgactctattacggatcag
tcgagtcaatcgaagtctacgaaatcagcaacacaatttagcgtgcaacgttcggatact
gatggactgcgcatgaaaatatcggctataaggaacccgccctcaacaacagcaacaatt
gaaaacagctcacgtaaaaagctagcaaaggtgcgaaagatgagcgaggctcaggagttg
agcggctgctcagcggatggcaaggagaagcatagagaaaaagagaaggagagggataaa
atgttgtcgacagtaaacacaaccaaaaagattaaagtcaagcgcaagaaaattgcgcaa
aagagcagcagcagcagcagtaataacaacaataacaatagcaaaactcttcgcaagcct
gcagcagcttttagttccgattctgaggatgatttgcccttaaaggtgcatatgcaacgg
gcgccacgattgctgctaacagctattggcggtagccagggccagggcgaaaaccacatg
ggtatctctagcagcgacaacgaggagctagtgagagcagcggatctggtgaaggcagcg
atcaagcgcgtagaaagcgatgctgaggataacgccagcgtggcagctggtgttgctgct
gcgaaaattaagcaacagctgccgcaatatcaatctacgctcctgaaggactttatggaa
aaaacgcaaagattgaatcagcctggccatgccaccagcttacccaaagcagcgatgcag
ccaagtgcagcagcggcagcagcagcagcagttaataacagcagcagcaacaacaacaca
ctatcgcagccactgcaacgcaagcgacgcggtcgcccaaaaaagttgcaaccaactgtt
gccaccagcgcacctgctgctcttcctgttgccgtgcccaccataaacgagtcggcagat
tcgggtgtgataagcacaacgccttcgcccaaaatgcagcagttgctgatcagtgataat
gccaagcccaaaatagacatggcctatctggataaacgcatgtacgcaacggcggagcgt
gtgttgtatccaccgccgcgcagcaagcgcagacagggcaacaagaaggtaaacaaagag
gagctgcaagtggatccactctggcgcaagattgatgtcaacaaaaagtttcgattgcgc
actgtcagtggctacaaaagcgatggcggcggcggtggcggcacctcaaatactatttgc
agcaagattcttgctgcgaaaagcggctacgtttcggactatggcagcgtgcggcatcag
cggcacaatcacaattcgggctacaaatctgatgccagctgcaagagtcgatatagcagc
cgcagctgtgccagtcgtcgcatgagtcgcgccaaaagttgtggctatcgcagcgactgc
aaggaatcctccggcaaatccagcaaatcactgcgtcgacgcagacgagcctccatgctg
agaagcggccatgagcaggcaacgcaggcgctgagcgatgagcatgatcaggatatattg
cagctggccggcctctcacttggccagagcagcgaggagagtaacgagtatatcagcaag
cccagcctaaagtgtttgcccagcaccagtgccagcaaaaagtatggtgaaatcaatcga
ttcgtggcaactggccaatatttcagtggagctgcaaagccaacaactacaagtgttgct
gctggagccaacacaacaacaacaaccaccacaacagcagcagataattttatacaaggt
aaaatgttgctgcagcgcaaacactcgattagccaggacacaatgctgcccggcaagagt
gcgtgcaaaattaagagtcgacgctcgtccgccgcgagcatgtgcagcagctatgtgtcc
ggtgcctcacgagtgcgtcgacggcatcgtcgcaaaagtttcagtcatgcgaaatcgctg
aacattgactccaagctgctaaccgagattgacataattgcaagtacatttcatgcgcgt
tgtcgcatccaggatgatcgcttaacggcgagcagcggcaaggagaagctgctcgccgag
gccaacaagctgcaggccacgctcacagcgcccattgcggccacgttgccgctgctaaat
ggcggtggcggcggcggcagcaacagcaccacatctgcagctgcaacaacaaagccgctc
aagcgggcactcaagaagcgcaagcttaacgagcccctaattgactttgccatgctctcg
gccagcgctggcaatagcaatggcatcagcaacaacaacagcagcagcagcaacggcgcc
aagcggcgacacaagaaatcgagcagcaacagcggcggcagcaacagctctagtcccgac
gatcacaagctaccgctgaagaagcgtcattatttggtaacaaccggcgccgaggtggca
tcggcttttgccagcaacggtaaactgaatgccgaagcttgggcagctgctgcagcggcg
gccaagagcagcgcaaataccaaagcccaggcgcagttcaatgccaagaagctaacgccc
aaaaagcggcatttgctggtcagtcaagaggtcgccagtggcgcagccgctacagctggc
agcgcttcgccgttgcgcattgtcgttgacaataattccataagcggtggcaagctgctg
gacataagccccagttcgctgtgttccctgaaacagcagcggcgtcagggcgccaaagca
aagaacttgcttgtggccagtgcgggtgcagttgctcgagagctgccccagcagctgcag
tcgcctgcaggaagcagcagctgtcctccgccaggcatttttgagccttccgtggagctg
gaaatacaaatacccatagccaaactcaatgagtcggtcatcacaaaatcggaggttgaa
tcacccctgctggccgcactagacatcaaggaggatgccaacaagaaggagcagtgccag
cgcgtgctggaaacgctgctgcacaaaaccggcggcaatttgttgctcaagcgcaaacgc
aagaaaatcaatcgcacaggctttcccacagttagacgtaagaagcgcaaggtcagcgtt
gagcacactctgttgccacagcaacagcagcagcagcagttggagcagcagcagcaacag
ttgcccgcgcgcgaaacacgcagcagcagcacccttgcagcggctttgacaatggactgt
gagcgagttccgaagacaggcgaggcgcaggaaacttttgtggcacgcagcagcaatcag
cgcacgccgcgtttgtctgtggttgcgctggagcgtttgcagagaccccaaacgccggca
aacagtggaggcaatgccagaggcaggccacgtggcagaggcagacctaagctgcaaaaa
ccacaaccaccagcaccacaacaacaacaacagcaatcacatccggtcgctcagctcttg
gaggtgcaaccggccaaaaagcgcgggcgcgctgccaagcaaacggagttgctggtgccc
aggctggagcgcaagctggagcctagcataaaactgccagcaggcattgatcccaataca
aactttagctgtaaaatacgcttaaagcgacgaaaaaccatacagcaggaggcagtcaag
caacttgagccagccaaacagccagagcagcagctgcggttagatgtgtccacgcctctg
gcaactagcgatgaccgaatgcaaattgcagccgaagcggcagccaagcgcagtcagcag
ccagtgccagcgagtgagcatgaacccttgcctgcccaggagtccacattgaatttggcc
accgactatggcagttgcagtgataccagcgaggataaatgcagcactgcatcgcagcgg
aagcgtaccaaactaaagaaaaactttttggtggcaggtctcttctccaattacttcaaa
cagttgccagctggagctgcagcaacggttccatccacagctgtcgctgtcaagcaacca
aacagaaaagctaccgatggggagcagacggagcagcagcagccgcaggtcagcgttctg
ctgccaccgcccagctattgcgagcgatatttcagacgcacccttaacgactttgagttg
ccgtatgatatttggtgggcctacagtcacgataagctgcccacgcgccatgtggtgccc
tcttggaattatcgcaaaatacgcactaatgtctatgcggaatcggtgcgtcctaatctg
gctggctttgatcatcccaactgcaattgcaagcctcaagcgagtggcgcctgtctggac
aattgcctgaatcgcatggtctatacagagtgtgcacccagtaattgcccagcgggcgac
aagtgtcgcaaccaaaagatacaacgtcatgaggtagcgccgggcgtggaacgtttcatg
accgcggacaagggctggggcgtgcgcaccaagctgcccatcgccaagggcacctacata
ctggagtatgtgggcgaggtggtcactgagcgtgagtttaagcagcgcatggctagcatt
tatctaaatgatactcaccactattgtttgcacctggatggtgggttggtaattgatggc
cagcgaatgggcagcgattgccgttttgtgaatcactcctgtgagcccaattgcgagatg
caaaagtggagcgtgaatgggctatcgcgcatggtgctattcgccaagcgtgccattgag
cagggcgaggagcttacctacgattacaatttctcgctatttaacccatccgagggtcag
ccgtgtcgttgtaatatgccgcagtgccgtggcgtcatcggcggcaagtctcaacgcatt
aaaccgcttcctgcggaactaaagacaactgccggtgcggagagtgcagcggctggatta
aaggaagccaacggtaatcaacatgggcgacaacggaagcacaaggccaagaagaatgcg
cagcgcctgcagcaagcagccaaagaggcaatggttgtggcacgcgtgcagcagctttcc
gagagagaaaagaaacttgttaagcagtgtaacatctttctggtacgcaatttcgagaag
attcgtcgctgcaaggctaagcgcgctgcggcaaaagcgcaggctgctgcttcaccagct
gctggggattctgatttaccaggacgtcgtccatcgacaccatcgtccagttcactgctg
gccgcacaaatctcggcactgtgcacgccgcgtaacatgaaaacgcgtggcctaacgcaa
gccgtacaggatccggaactggagaagatggctaaaatggcggttgtgttgcgtgacatt
tgcacagcacttgaatcgctgaaaatgttcgatctgctctccacgttgcccagcagcaag
aaaaagaagcagctaaagacgacgcgtctcgactttaaaaccattcaagcacaggtggaa
caaggacattataaaaccccacaggcatacgatgagcacatgctacagctcttcgcagag
gcacgtcaattacacggcgacgacgagggcaagtccaatgcgctgcaaacgctgctggaa
agctatacgcagcagaaggcggccaactacgcacagctgctggatatacttggcaaacca
gaggcattgcacagttttaagcccaaggaagaggaggaggagaaggtggcggagctagcg
acagcaacagaccagtcacaggagaacataaagccgagtacaaaagtaattgcgtccgcg
acgccagaaactagtgcagctgttgatgttggtccagagctgccgccaaccgatgaggaa
gatgtgatacgttgcatatgtggcctgtacaaggacgaaggtcttatgattcagtgcgcc
aaatgcatggtctggcagcatacggagtgcacgaaggcagacatagatgcggataactat
cagtgtgagcgctgcgaaccgcgtgaagtggatcgcgaaatacccctggatgagtacacg
gaagagggacatcgctactatctatcgctaatgcgtggcgagcttcaggtgcgccagggc
gacgccgtttacgttttacgcgacatacctattaaggatgagacaggcaaggtgctgccc
agccagaaacacacgtacgagaccattggagcgattgattatcaggagtgtgacattttt
cgcgttgagcatctgtggaagaacgaggcgggcaaacgtttcatctttggccaccacttt
ttgcgtccacatgagactttccatgagccctcgcggcgattttatcccaacgaggtggtt
cgcgtctcattgtacgaggtagtgcccatcgagctagtgattggacgctgctgggtgcta
gatcgcaccacattctgcaagggccggcccatggagtgtaacgatgaggatcattgctac
atatgtgagctgcgcgtggacaaaactgcgcgtttcttttccaaggccaaggcgaatcat
ccggcctgcaccaagagctatgcctttagaaagtttccggaaaaacttaagatctcaaaa
agctatgcgccacatgatgtggatccgtcgttgttgaaaacgaggaagcaaaagactgat
atagaagtaggagcaacgcccattaaaatgagcaggcacgagcagaagacaggtcagaca
acgggcaacagaaagcagcgtaacacacaggcagggacagctaccggagcgactgcatca
acacaagtacctgttcaagtattaacgcccgtcgcgccaaatggacaggttctcaaaaag
aagcgctcacgcttggaaaatgttcttaataccatgaagctcaaatgtctggatgcgcag
acagcgcaggagcagccaatcgatttgtcctacttgctaagtggacgcggcgcccgacaa
cgcaaaaccaactgcaccagcaacggcggcagcagcagcaacaacaacaattcggcaacg
ccgtgcgcctag

DBGET integrated database retrieval system