KEGG   Drosophila virilis: Dvir_GJ11955Help
Entry
Dvir_GJ11955      CDS       T01066                                 

Definition
GJ11955 gene product from transcript GJ11955-RA
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
dvi  Drosophila virilis
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Dvir_GJ11955
Enzymes [BR:dvi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Dvir_GJ11955
Exosome [BR:dvi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dvir_GJ11955
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 528 aa AA seqDB search
MTKGLKSAKYPAWCILALALMTCPAWADLSDEQENEQHPRMSASRDYVELDEELNTRFWH
DKAQSILADKLSHHKKLNENRAKNVILFLGDGMSVHTIAATRAFMGDSSKQVSFEKFPYV
GLSKTYAVDERTPDSASTATAYLSGVKGNYGTIGVNAQVKRGDCLAGTDKTTHTESIAQW
AQEAGKWAGLVTTARVTHASPAGVYAHVADRNWEHDGKINCSAELNTDIARQLVEWPVGR
GLRVVLGGGRASFRDKSMRDEEGFVGKRKDGRDLIKDWQADKQQQGAEAHYVWSRDGLNK
LDLTKTDYLLGLFDVSHCPYHGDRMRQHMDYLEPSLSEMTEAAIKVLSRNEQGYFLFVEG
ARIDMAHHATKAQKALEDTEEFARAVELARSLTSEEDTLIVVTSDHSHTMTINGYPYRRQ
NILSLAPNQAEDELPFTILSYANGPGFVNTYDENGRVDLSHTNTKDADFQFQATVPLKTE
THGGEDVGVFASGPHEHFFSGNYEQSTIPALMAYAANIGPFAPDKLKN
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaggcttaaaaagtgctaaatacccagcgtggtgcattctggccctggctctg
atgacgtgcccggcctgggcagatttatccgacgagcaagagaatgaacaacatccacgc
atgagtgcctcgcgtgactatgtcgaactggacgaggagctcaacacacgtttctggcac
gataaggcgcagtctatactggccgataagttgtcgcatcataaaaaactcaatgagaat
cgtgccaagaatgtgatactgttcctgggcgatggaatgtctgtgcacacgatagcggca
acacgtgccttcatgggcgacagcagtaagcaggtctccttcgaaaaattcccctatgtg
ggcctctccaagacgtatgcggtggatgagcgcacgccggactcggccagcacggcgaca
gcttacttgagcggtgtcaagggcaactatggcaccattggcgtgaatgcccaggtgaag
cgaggcgattgcctggcgggcaccgacaagaccacacacacggagagcattgcacaatgg
gcacaggaggcgggcaagtgggcgggtctggtgacaacggccagggtgacacacgcatct
ccggccggtgtttacgcacacgttgccgatcgtaactgggagcacgatggaaagatcaac
tgcagcgcggagctcaatacggatattgcacgccagctggtggaatggccggttggtcga
ggtttgcgtgtggttctaggcggcggtcgtgcctccttccgcgataagagcatgcgcgat
gaggagggctttgtgggcaaacgtaaggacggacgcgatttgatcaaggactggcaggcg
gataagcaacaacaaggcgctgaggcgcactatgtctggtcgcgcgatggtctcaacaaa
ctggaccttaccaagactgactacctgttgggtctattcgatgtcagccactgcccctac
catggcgatcgcatgcgccagcacatggattacctggagccctcgctctccgagatgaca
gaggcggccatcaaggtgctgagtcgcaacgaacagggctactttctctttgtggagggc
gcacgcattgacatggcccaccacgcgacgaaggcacaaaaggctctcgaggacaccgaa
gagtttgcacgcgctgttgagctggcacgcagtctcacctctgaggaggacacgctcatt
gttgtcacctcggatcactcgcacaccatgactatcaatggctatccttatcgtcgtcag
aatatactttcactggctcccaatcaggccgaagatgagctgcccttcactatactctct
tatgccaatggaccgggttttgtgaatacctacgatgagaacggccgcgtggacctgtcg
catacgaataccaaggatgctgacttccagttccaagccacagttcctctcaaaactgag
actcacggcggcgaggatgtgggcgtctttgcctcgggtccccatgagcacttcttctcc
ggaaactacgagcaatcgacaatacccgctctgatggcttatgcggccaacattggcccc
tttgccccggacaagttaaagaattag

DBGET integrated database retrieval system