KEGG   Drosophila virilis: Dvir_GJ11980Help
Entry
Dvir_GJ11980      CDS       T01066                                 

Definition
(RefSeq) GJ11980 gene product from transcript GJ11980-RD
  KO
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
dvi  Drosophila virilis
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Module
Nucleotide sugar biosynthesis, eukaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dvir_GJ11980
   00052 Galactose metabolism
    Dvir_GJ11980
   00500 Starch and sucrose metabolism
    Dvir_GJ11980
   00520 Amino sugar and nucleotide sugar metabolism
    Dvir_GJ11980
Enzymes [BR:dvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Dvir_GJ11980
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 520 aa AA seqDB search
MTSGIRPIDVLLQRAGMRGHQRAPSDSKEFHEVTKRDALRLLENDVDRLLQTTEPARRPA
LQAEMGRFADLFGRFLQEEGPALDWNKIQKLPENAVMNYSNLKSPKNEQNEIRNMLDKLV
VIKLNGGLGTSMGCHGPKSVIPVRSDLTFLDLTVQQIEHLNKTYDANVPLVLMNSFNTDE
DTEKIVRKYKGFRVQIHTFNQSCFPRISREHFLPVAKDFDVEKDMEAWYPPGHGDFYDTF
RNSGLLKKFIGEGREYCFLSNIDNLGATVDLNILNKLVGEERASTPFEFVMEVTDKTRAD
VKGGTLIQMENKLRLLEIAQVPPEHVDDFKSVKTFKFFNTNNIWANLSAIDRVLRERTLN
MEIIVNNKTLENGLRVIQLETAVGAAMKCFDGAIGINVPRSRFLPVKKSSDLLLVMSNLY
TLKNGSLVMSPQRMFPTTPLVKLGENHFSKVKEFLGRFANIPDIIELDHLTVSGDVTFGR
GVSLRGTVIIIANHGDRIDIPAGAILENKIVSGNMRILDH
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcaggcatacgacccattgatgtgctgctgcaacgcgccggtatgcgcggccat
cagcgcgccccatccgattcgaaggagttccatgaggtaaccaagcgcgatgcactgcgt
ctgctggaaaacgacgtggatcgtctgctgcagaccacggaaccggctcgtcgaccagca
ctccaagctgaaatgggtcgatttgcggatctgtttggtcgcttcctgcaagaggaggga
ccagcgctggattggaataaaatccaaaagctgcccgaaaatgcggtcatgaactactcc
aatctcaagtcgcccaaaaacgagcagaatgagattcgcaatatgttggacaaactggtg
gtcattaagctgaatggtggtctgggcacctcgatgggttgccatggacccaagagtgtt
atacctgtgcgttccgatttgacattcttggatctgacggtgcagcaaatcgagcatctg
aataagacatacgatgccaatgtgccgctggtgctgatgaactccttcaatacggatgag
gacacggaaaagattgtgcgcaagtacaagggcttccgcgtgcagatacacaccttcaac
cagagctgctttccacgcatcagtcgcgagcatttcctgccggttgccaaggatttcgat
gtggaaaaggacatggaggcctggtatccacctggtcacggtgacttctacgataccttc
cgtaactcgggtctgctgaagaagttcattggcgagggccgggaatactgtttcctgtcc
aacattgacaatctaggcgccaccgtcgatctgaacatactcaacaagctggtgggcgag
gagcgcgccagcacgccattcgagttcgtcatggaggtcaccgacaagacccgtgctgat
gtcaagggtggcacgctcatacaaatggagaacaagttgcgcctgctggaaatcgcccag
gtgcctccagagcatgtggatgactttaagtctgtcaagaccttcaagtttttcaatacc
aacaacatttgggccaatctgtcggctatcgaccgtgtgctgcgtgaacgcacgctcaac
atggagattattgtaaacaacaagacactggagaatggtctacgcgtcattcagctggag
acggcggtgggtgcggccatgaagtgtttcgatggcgccatcggcatcaatgtgccccgt
tcgcgtttcttgcccgtgaagaaatcgtctgatctgttgcttgtcatgtcgaatttgtat
acgcttaagaatggcagcctggtgatgtcgccgcagcgcatgttccccaccacgccgctt
gtgaaactgggcgagaatcatttctccaaggtcaaggagttcttgggtcgcttcgccaat
atacccgatattattgaactggatcatttgacggtcagcggcgatgtgacctttggtcgc
ggcgtctccttgcgcggcactgtgattattattgccaatcatggtgatcgtatcgatata
cccgctggcgccatactggagaacaaaattgtgtctggcaatatgcgcatcttggatcat
taa

DBGET integrated database retrieval system