KEGG   Drosophila virilis: Dvir_GJ12023Help
Entry
Dvir_GJ12023      CDS       T01066                                 

Definition
GJ12023 gene product from transcript GJ12023-RA
Orthology
K05635  
laminin, gamma 1
Organism
dvi  Drosophila virilis
Pathway
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    Dvir_GJ12023
Cell adhesion molecules and their ligands [BR:dvi04516]
 1. Immunoglobulin Superfamily
  Neural system
   Enzymatic CD
    PTPRF, LAR; receptor-type tyrosine-protein phosphatase F [KO:K05695]
     Laminin-1 Extracellular matrix (ECM) components
      Dvir_GJ12023
 2. Integrin Family
  Beta1 integrins
   VLA-1
    ITGB1; integrin beta 1 [KO:K05719]
      Dvir_GJ12023
     Laminin-2 Extracellular matrix (ECM) components
      Dvir_GJ12023
   VLA-2
     Laminin-1 Extracellular matrix (ECM) components
      Dvir_GJ12023
   VLA-3
      Dvir_GJ12023
     Laminin-10 Extracellular matrix (ECM) components
      Dvir_GJ12023
     Laminin-11 Extracellular matrix (ECM) components
      Dvir_GJ12023
   VLA-6
     Laminin-1 Extracellular matrix (ECM) components
      Dvir_GJ12023
     Laminin-8 Extracellular matrix (ECM) components
      Dvir_GJ12023
   VLA-7
     Laminin-1 Extracellular matrix (ECM) components
      Dvir_GJ12023
  Beta4 integrins
   alpha 6 beta 4
    ITGB4; integrin beta 4 [KO:K06525]
     Laminin-1 Extracellular matrix (ECM) components
      Dvir_GJ12023
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1641 aa AA seqDB search
MRRNRRSLSEGFSAARLLLAGALLCSCATATLGVQRQPINSAGGHELRGTTFMPALECYD
PYGRPQKCLPEFINAAYQLQIESTNTCGEQGDNHFCMQTMNPNHKNCAFCRYEDHKPTYL
TDLHDPQNPTWWQSETMLEGIQHPNHVNLTLHLRKSYDITYVRILFRSPRPESFTIYKRT
SENGPWIPYQFYSAACRDTYYLPDSRAIRKGEGEAHALCTSEYSDISPLRDGEIAFSTLE
GRPSGINFERSAELQEWVTATDIRITLDRLNTFGDELFGDSQVLKSYFYAISDIAVGARC
KCNGHASKCVASTGMHGERTLVCECRHNTDGPDCDRCLPLYNDVKWKRATSTEVNECKAC
NCNGFADKCYFDANLFNQTGHGGHCLDCRDNRDGPNCERCKENFYMRDNAYCINCGCDPV
GSRSLQCNSQGKCQCKPGVTGDKCDRCANNYFQFGPHGCQPCGCDPRGSHDNTPACDAES
GICFCKENVEGRRCNECKPGFFNLDKSNRFGCTPCFCYGHTSECQTAPGYSIVSVTSSFN
KHKERWTAIDLNRRDVDIKYNQYSRSIGTTAQGNEYVYFQAPDRFLGDQRASYNRDLKFK
LQLVGQVGPSSSASDVILEGAGSKISLPIFAQGNGIPDQGVKEYTFRLHEHHDYQWQPSQ
SARGFLSILSNLTAIKIRATYSVQGEANLDDVELQTAHRGAAGQPATWIEQCTCPEGYLG
QFCESCAPRYRHSPARGGPFMPCIPCDCHGHADICDSETGSCICQHNTQGDNCDQCAKGY
YGNALGGTPYDCKRCPCPNDGACLQINGDTVICTECPVGYFGSRCEQCSDGFYGDPTGLL
GEVQTCKSCDCNGNVDPNAVGNCNRTSGECLKCIHNTAGEHCDQCLPGHFGDPLALPHGK
CDRCSCYAAGTEQDEQSISRCDQVTGQCQCKPNVIGRDCGECQPGYFNIRSGNGCENCLC
DPVGSYNSTCDRYTGQCHCKPGVVGVRCDQCANYFFGFSVEGCKPCECDESGSKGFQCDQ
NGQCPCNDNVEGRRCDRCKENKYDRHRGCVDCPDCYNLVQEAANLHRAKLANLSSTLDEI
ARTPVTNDEEFEGKLKAVQEKVAILAQDARSGSGEGGQTYVEVINDLHKRLDSMRSHLVS
ADALQQDANAEIAKARSNYTQLHKIIDDAKKELQEALDLLNDEGAQALAKAQNKSVEFGE
QSEQISDISREARALADRLESEAQFDLKNAKDAKDAVEKAHLLAKNAIDLQQKVGVELRS
EVRLELNQVKQSLGTVVQTSKEALRKANEVYDAALTLLNDVNRQTQPDIDINKLKKEAVS
ANERADDLLKQINELSNSNGEVFADFEAESSFAQVLLERADAQKKDDIELLERAKAAHER
ATKAVQQGDSTLKEANDTYNTLAGFQSDVQRSSEKAALALQTVPSIEMEIENAGNLIRQA
GEALEGANKNANEAKSNAQEAQEKYAEQASKDAELIRRTANETKVAARKLRDEADQLNHR
VKLTEMNIFNLEDNSTKDDNLVDDAKRKVGQAKADTQEAQKQIEKANAELTAIKDELENL
RDINTDDLDKLENRLTVVESDINRVNLTGRIEKYREQRNIQKKLIDKYEAELADLSGEVD
NIRLISEALPSGCFRRNRLEP
NT seq 4926 nt NT seq  +upstreamnt  +downstreamnt
atgaggcgcaacaggcggagtctcagcgaaggcttctccgcggcgcgtctgctgctcgcc
ggagcgctgctctgcagctgtgcgacggctacacttggcgtacaacgccagcccatcaac
tccgccggcggacacgagctgcgcggcaccacatttatgccggccctggagtgctacgat
ccgtatggccgaccgcagaaatgcttgcccgaatttataaatgctgcctaccaattgcaa
atcgaatcgacgaatacctgcggtgagcagggggataatcacttctgtatgcagaccatg
aatccgaatcacaaaaactgcgccttctgcagatatgaagaccacaagcccacatacttg
acggacttgcatgatccacagaatcccacctggtggcaatcggagacaatgctggagggc
atacaacatcccaaccatgtgaatctaacgctgcatttgcgtaaatcctacgacataact
tacgtgcgcattctcttccgttcgccacgtcccgagtcctttacgatttacaaacgcacc
tcggagaacggcccctggataccctaccagttctacagtgccgcctgtcgggacacctac
tatctgcccgattcgcgtgctattcgcaagggcgagggcgaggctcacgccctctgcacc
agcgaatacagcgacatctctccgctgcgtgacggtgaaattgccttctccacgctcgag
ggtcgcccgagcggcatcaattttgagcgcagtgcggagctgcaggagtgggtaacagcc
accgacattcgcatcacactggatcgcctaaataccttcggtgacgagctgttcggcgat
tcccaagtactgaagtcctacttctatgccatcagcgatattgcggtgggtgcgcgctgc
aagtgcaacggacatgccagcaagtgtgtggccagcactggaatgcatggggagcgtaca
ctggtctgcgagtgtcgccataatacagacgggcccgactgtgatcgctgcttgccgctc
tacaatgacgtcaagtggaagagggcaacctcaaccgaagtgaacgagtgcaaagcttgc
aactgcaacgggtttgcggacaaatgctacttcgatgcgaatctattcaatcagacgggt
cacggcggccactgcctggattgtcgcgacaatcgtgatggacccaactgcgagcgctgc
aaggagaacttctatatgcgcgacaacgcctactgcatcaactgtggctgcgatcccgtc
ggctcccgttcgctgcagtgcaacagccagggcaagtgccagtgcaagcccggtgtgaca
ggcgacaagtgcgatcgatgcgccaacaactacttccagttcgggccccatggatgccag
ccatgtggctgcgatccgcgcggctcccatgacaatacgccagcctgcgatgccgagagc
ggcatttgcttctgcaaggagaacgtcgagggcaggcgctgcaacgaatgcaagccgggc
ttcttcaatctggataagagcaatcgctttggttgcacgccctgtttctgttatggccac
acctccgagtgccagaccgcacccggctactccattgtctccgtcacctccagcttcaac
aagcacaaggaacgctggacagcaattgatctgaatcgccgtgacgtggatatcaaatac
aatcagtatagtcgcagcattggcaccacagctcagggcaatgaatacgtatatttccag
gcgccggatcgcttcctgggcgatcagcgtgcctcctacaatcgcgaccttaagttcaag
ctgcagctcgtgggtcaggtgggacccagcagcagtgccagcgatgtcatccttgaaggc
gccggcagcaaaatctcactacccatttttgcccagggcaacggcataccggaccagggt
gtcaaggagtacactttccgtttgcatgaacatcacgactatcagtggcagcccagccag
tcggcgcgaggctttctctcgatactatccaatctgacggctataaagatcagggccacc
tattccgtgcagggcgaggccaatctggacgatgtggagctgcaaacggcgcacaggggc
gctgccgggcaaccggcaacctggattgagcagtgcacctgccccgagggctatctgggc
cagttctgcgagtcctgcgcgccacgctatcgccacagtccggcacgtggcggacccttt
atgccctgcataccttgcgactgtcatggccatgcggatatctgtgattcggaaacgggc
agctgcatctgccagcacaacacacagggcgataactgtgaccagtgcgctaagggctac
tatggcaacgccttgggcggcacaccctatgactgcaagcgctgtccctgccccaacgat
ggtgcctgcctgcaaattaacggcgacacggtcatctgcacagaatgccccgtgggctac
tttggctcccgctgcgaacagtgtagcgacggcttctatggagatcccactggcctgctc
ggcgaggtgcagacctgcaagagctgcgactgcaatggcaatgtcgatcccaatgcggtg
ggcaactgcaatcgcaccagcggcgagtgcttgaagtgcatccataacacagctggcgaa
cactgtgaccaatgcttgcccggacactttggtgatccgctggccctgccccacggcaag
tgcgatcgctgtagctgctatgccgccggtaccgagcaggacgagcagagcatctcgcgc
tgcgaccaggtcactggccagtgccagtgcaagcctaatgtgattggacgcgactgcggc
gagtgtcagcccggctactttaatatacgatccggcaatggctgcgagaactgtctgtgc
gatcctgtcggcagctacaattccacatgcgacaggtatacgggccagtgccactgcaag
ccgggcgtcgtgggcgtgcgctgtgaccagtgcgccaactacttctttggcttctctgtg
gagggctgcaagccgtgcgagtgcgacgagagcggctccaagggcttccagtgcgatcag
aatggccagtgtccatgtaatgacaatgtggagggacgtcgctgcgatcgctgcaaggag
aacaaatacgatcgccatcgtggctgtgtggactgtccggattgttacaatctggtgcag
gaggcggccaatttgcatcgcgccaagctagccaatttgagctctactctggacgagatc
gcacgcacgccagtgaccaacgatgaggagttcgagggcaagttgaaggcagtgcaggag
aaggtggccattttggcacaggatgcgcgctccggttctggcgaaggcggccaaacttat
gttgaggtcatcaacgatctgcacaagcgcctggatagcatgcgcagtcatttggtaagt
gccgatgcacttcagcaggatgccaacgcggaaatcgccaaggcacgcagcaattacacg
cagctgcacaagatcatcgatgatgccaaaaaggagctgcaggaggcattggatctgctc
aatgatgagggtgcgcaggccttggccaaggcccagaacaagtccgtggagtttggcgaa
cagtccgagcagatatcggacatttcacgcgaggcacgtgctcttgccgatcgcctcgag
tcggaggcgcagttcgatctaaagaacgccaaggacgccaaagatgctgttgagaaggcc
catctgctggccaagaatgccatcgacttgcagcaaaaggtcggcgttgagcttcgctct
gaagtgcgcctcgaactgaatcaggtcaagcaatccctgggcactgtcgtccaaacctcg
aaggaggcgctgcgcaaggccaacgaggtgtacgatgcggccctcacgctgctcaacgat
gtgaaccgacaaacccagccggacattgacatcaacaagctgaagaaggaggccgtgtcc
gccaatgagcgcgccgatgacctgctcaagcagatcaacgagttatccaacagcaatggc
gaggtctttgccgattttgaggcagaaagtagttttgcccaggtacttctcgaacgcgcc
gatgcacaaaagaaggatgacatcgagctcttggagcgcgccaaggctgcccacgaacgc
gccaccaaggcggtacagcagggcgacagtacactcaaggaagccaacgatacctacaac
actctggccggctttcagtcggatgtgcagagatcttcggagaaggctgccttagcattg
caaacggtgcccagcatcgagatggaaattgagaatgctggcaatctgattcgccaagct
ggtgaggctctagagggtgccaacaagaatgccaatgaggccaagagcaatgcccaggaa
gcgcaagagaagtatgccgaacaggcctctaaggatgccgaactgatccgccgcacggca
aatgagaccaaggtcgctgcccgcaagctacgcgacgaggctgaccagctgaatcatcgc
gtgaagctgactgaaatgaatatcttcaatctggaggataattcaaccaaagatgacaat
ctcgtggatgatgccaagcgcaaggtgggtcaggccaaggctgacacgcaggaggcacaa
aaacaaattgaaaaggccaacgcagagctgacagcgatcaaggacgagctggagaacttg
agggacatcaacacagatgatttggataaattggaaaatcgcctcactgtcgtggagagc
gacatcaatcgagtgaatctaactgggcgcattgagaagtaccgagaacagcgcaatatc
caaaagaaattaattgacaaatacgaagcagagttggccgatttatccggtgaggtggat
aatatacgtttaatatctgaagcactgccaagtggttgctttaggcgcaatcgcctggag
ccctag

DBGET integrated database retrieval system