KEGG   Drosophila virilis: Dvir_GJ12231Help
Entry
Dvir_GJ12231      CDS       T01066                                 

Definition
GJ12231 gene product from transcript GJ12231-RA
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
dvi  Drosophila virilis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Dvir_GJ12231
Enzymes [BR:dvi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Dvir_GJ12231
Exosome [BR:dvi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dvir_GJ12231
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 327 aa AA seqDB search
MDRKLHSGIHHPTLRLLQESGCEIVPHNLMYPVFIISNDDEEQPISSMPGISRYGVNRLR
EHLEPLLEKGLASVLLFGVIECDLKDELASHADSSLNPVVQALPKLRKWFPDLLIACDVC
ICPYASHGHCGLLSDNGLENAQSIKRIANIAVAYGKAGAHIVAPSDMMDNRVRAIKQALI
DANLNSVSLLAYSAKFASNFYGPFREAAQSAPAFGDRRCYQLPSGSRNLAMRAVQRDVSE
GADMLMVKPGMPYLDILRQTKDTYPYHTLYVYQVSGEYAMLYHASQAGAFPLREAVLESM
KGFKRAGADCIITYFTPYLLDIISKSA
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggatcgaaaactgcacagcggtatacatcatcctacgctgcggctgctgcaggagtct
ggctgtgaaatagtgccacacaacctgatgtatcctgtcttcataatcagcaacgacgat
gaggaacaacccatttcgagcatgccgggcatatcacgctacggcgtgaaccgattacgc
gagcacttggagcccctgctcgaaaagggtttggcgtcggtgttgctctttggcgtgata
gagtgcgacctcaaggatgagctggcctcccatgcggactcgtcgctgaatcctgtggtc
caggcattgcccaagctgcgcaaatggtttccagatttgctcatagcctgtgacgtgtgc
atctgtccgtatgcctcgcacggccactgcggccttctgtccgacaatggcctggagaat
gcgcagagcatcaagcggatagccaacattgcggtggcctatggcaaagctggcgctcac
attgtggccccctcggacatgatggacaaccgcgtgcgagcgattaaacaggcgctgatt
gacgccaatctgaacagcgtttcactgctggcctactcggcgaagtttgcgtccaacttc
tatggccccttcagagaggcagcacagtcggcgccagctttcggagatcgtcgctgctat
cagctgcccagtgggtcgcgcaatctggccatgcgggcggttcagcgtgatgtcagcgaa
ggcgccgacatgctcatggtaaagcccggcatgccctacctggacatcttgcgccagacc
aaggacacatatccataccacaccctgtacgtttatcaggtgtctggcgagtatgccatg
ctatatcatgcttcccaggcgggcgcctttccattgcgcgaagcggtgctggagtcaatg
aagggcttcaaacgtgccggtgccgattgcattataacctattttacgccctatcttctg
gatataatcagcaaatcggcgtaa

DBGET integrated database retrieval system