KEGG   Drosophila virilis: Dvir_GJ12494Help
Entry
Dvir_GJ12494      CDS       T01066                                 

Definition
GJ12494 gene product from transcript GJ12494-RA
Orthology
K14545  
ribosomal RNA-processing protein 7
Organism
dvi  Drosophila virilis
Pathway
Ribosome biogenesis in eukaryotes
Class
Genetic Information Processing; Translation; Ribosome biogenesis in eukaryotes [PATH:dvi03008]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 266 aa AA seqDB search
MTEIEGYRVVPLRMSPDAKHCHSVYMREHFIRLMDPNKPKGRTLFLLNVPPYITEESLQT
FFKRVGNVESVLFAEKPGRDETAKWYEGTDVPFSNVQTPFKFKVAYVVFQKSISIGRALA
LESLDLYNSSGECLIKTGMELWHDDYENNYILDVEKTQKEINDYMAAYDKRERAALAAAK
TSEADPDGWVTVGKDGRNAGFEQKESVIGRIESKLEKDKKTKELKNFYTFQIRESKMQNI
VELRQKYEEDKQKIELLKKSRRFRPF
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaatagaaggctatagagttgtgccgctgcgaatgtcgccggatgcgaaacat
tgtcacagcgtttacatgcgcgagcatttcatacgcctaatggatcccaacaagccaaaa
ggccgcacgctatttctgctcaacgtgccgccgtatataacagaagaaagcctgcagaca
ttctttaagcgcgtcggcaacgtggagagcgttttgtttgccgagaaacctggacgcgat
gagacagccaagtggtacgaaggaacggatgtgcccttctcgaatgtacagacgcccttc
aagttcaaggtggcctatgtggtcttccagaagagcatcagcattggccgggcgctggcc
ttagagagcctcgacttgtacaacagcagcggcgagtgcctgattaaaacgggcatggaa
ctgtggcacgacgactacgagaacaattacatactggatgtggagaagacccaaaaggaa
atcaatgactatatggctgcctatgataagcgggagcgtgccgcactggcggcagccaaa
acaagcgaagcggatcccgatggttgggtcacggtgggcaaagatggtcgcaatgcgggc
tttgagcagaaggaatctgttattgggcgcatcgaaagtaaattggaaaaggataagaaa
accaaggagctcaaaaacttttacacatttcaaatacgtgaaagcaaaatgcaaaatatt
gttgagctgcgtcagaaatacgaggaggataagcaaaaaatcgaattacttaagaaatcg
agacgcttccgaccattttag

DBGET integrated database retrieval system