KEGG   Drosophila virilis: Dvir_GJ12505Help
Entry
Dvir_GJ12505      CDS       T01066                                 

Definition
GJ12505 gene product from transcript GJ12505-RA
Orthology
K13915  
lysozyme C [EC:3.2.1.17]
Organism
dvi  Drosophila virilis
Brite
Enzymes [BR:dvi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     Dvir_GJ12505
Exosome [BR:dvi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dvir_GJ12505
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 143 aa AA seqDB search
MKAFIVLVALAFAALTLGRTMSRCTLAREMFKLGVPRNQLDKWTCIAERESNYRTGVVGP
KNTNGSHDYGIFQINDLYWCEPSHGQSYGRSSNGCEIDCDDLLSDSIVNDVRCAQLIQRM
QGWCAWTTWHYCNGDLPSIDDCF
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctttcattgttttggttgctctggcttttgccgccctcactctcggtcgcacc
atgagccggtgcaccttggcccgcgagatgttcaaattgggcgttcctcgtaaccagctg
gacaagtggacctgcattgccgagcgcgagagcaactaccgcaccggcgtggttggtcca
aagaacacgaatggttcccacgactacggcatcttccagatcaacgacttgtactggtgc
gagccctcccacggtcagtcctacggtcgctccagcaacggttgcgaaatcgactgcgac
gacctcttgagtgacagcattgtcaacgacgtccgttgtgcccagcttatccagcgcatg
cagggctggtgcgcctggaccacctggcactactgtaacggtgatctgccctccatcgac
gactgcttctaa

DBGET integrated database retrieval system