KEGG   Drosophila virilis: Dvir_GJ12520Help
Entry
Dvir_GJ12520      CDS       T01066                                 

Definition
GJ12520 gene product from transcript GJ12520-RA
Orthology
K03259  
translation initiation factor 4E
Organism
dvi  Drosophila virilis
Pathway
RNA transport
mTOR signaling pathway
Module
eIF4F complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:dvi03013]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:dvi04150]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 240 aa AA seqDB search
MGYDNYNNGTEVAESGQAAAAAIYAGGNGNMVADEQFAAAAAELQPSLNRVLSSIDYDLC
FKHPLEHTWTLWHWENDRTKSWSDMLSDVTSFNTVEDFFSVYYFIKPPSDLKVFNDYMVF
KHGIRPMWEDDVNKDGGRWVMFLDKDSKELVDKLWHDLLLCTIGECFEYSDQICGVVINV
RNKASKISLWTKDSHNQQAILAIGRKMKQLLQLREVELQYQVHKDAMVQAGPNVNAIYKL
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgggctacgacaactacaacaacggcaccgaggtcgccgaatctggccaggcggcggcg
gcggccatctatgccggcggcaatgggaatatggtcgccgatgaacaatttgctgccgcc
gcagcggagctgcagccgtcgctgaatcgtgtactcagctcgattgattatgatttgtgc
ttcaagcatccgctggagcacacctggacgctgtggcattgggagaacgatcgcaccaaa
tcctggtccgatatgctcagcgatgtgaccagcttcaatacggtcgaggatttcttcagc
gtctactattttattaagccaccatccgatctgaaggtattcaatgattacatggttttt
aagcatggcatacgcccaatgtgggaggacgatgtcaacaaggacggcggacgttgggtt
atgtttctggacaaggattccaaggaactggtagacaagctctggcatgatttgctgctg
tgcacaattggcgagtgcttcgagtattcggatcaaatctgtggcgtggtcatcaatgtg
cgcaacaaggccagcaaaatatcactgtggaccaaggactcgcacaatcaacaggcgatt
ttggcaattggacgcaaaatgaagcagctgctgcagctgcgcgaggtggaactgcagtac
caggtgcacaaggatgccatggtgcaggcggggcccaatgtgaatgccatttacaagttg
taa

DBGET integrated database retrieval system