KEGG   Drosophila virilis: Dvir_GJ12548Help
Entry
Dvir_GJ12548      CDS       T01066                                 

Definition
(RefSeq) GJ12548 gene product from transcript GJ12548-RA
  KO
K05759  
profilin
Organism
dvi  Drosophila virilis
Pathway
MAPK signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    Dvir_GJ12548
Membrane trafficking [BR:dvi04131]
 Others
  Actin-binding proteins
   Others
    Dvir_GJ12548
Cytoskeleton proteins [BR:dvi04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     Dvir_GJ12548
Exosome [BR:dvi04147]
 Exosomal proteins
  Proteins found in most exosomes
   Dvir_GJ12548
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 126 aa AA seqDB search
MSWQDYVDNQLLASQCITKACIAGHDGNIWAQSNGFEVTKEELAKLISGFDQQDLLTSSG
VTLAGQRYIYLSGTDRVVRAKLGRNGVHCMKTTQAVIVSIYEDPVQPQQAASVVEKLGDY
LITCGY
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgagctggcaagattatgttgataatcaacttttggcctcgcagtgcatcaccaaggcg
tgcattgccggacacgatggcaacatttgggcgcagtccaatggctttgaggttacaaag
gaggagctggccaaattgatcagcggctttgatcagcaagacctgcttaccagcagcggc
gtaacattagccggccaacggtacatttacctctcaggcacagatcgcgtggtgcgcgca
aaactgggcagaaacggagtgcactgcatgaagacgacacaagccgtcattgtttccatc
tacgaggatcctgtgcagccccagcaggccgcttccgtggtggagaaacttggagattat
ctgattacttgcgggtactag

DBGET integrated database retrieval system