KEGG   Drosophila virilis: Dvir_GJ12548Help
Entry
Dvir_GJ12548      CDS       T01066                                 

Definition
GJ12548 gene product from transcript GJ12548-RA
Orthology
K05759  
profilin
Organism
dvi  Drosophila virilis
Brite
Exosome [BR:dvi04147]
 Exosomal proteins
  Proteins found in most exosomes
   Dvir_GJ12548
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 126 aa AA seqDB search
MSWQDYVDNQLLASQCITKACIAGHDGNIWAQSNGFEVTKEELAKLISGFDQQDLLTSSG
VTLAGQRYIYLSGTDRVVRAKLGRNGVHCMKTTQAVIVSIYEDPVQPQQAASVVEKLGDY
LITCGY
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgagctggcaagattatgttgataatcaacttttggcctcgcagtgcatcaccaaggcg
tgcattgccggacacgatggcaacatttgggcgcagtccaatggctttgaggttacaaag
gaggagctggccaaattgatcagcggctttgatcagcaagacctgcttaccagcagcggc
gtaacattagccggccaacggtacatttacctctcaggcacagatcgcgtggtgcgcgca
aaactgggcagaaacggagtgcactgcatgaagacgacacaagccgtcattgtttccatc
tacgaggatcctgtgcagccccagcaggccgcttccgtggtggagaaacttggagattat
ctgattacttgcgggtactag

DBGET integrated database retrieval system