KEGG   Drosophila virilis: Dvir_GJ12686Help
Entry
Dvir_GJ12686      CDS       T01066                                 

Definition
GJ12686 gene product from transcript GJ12686-RA
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
dvi  Drosophila virilis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dvir_GJ12686
   00052 Galactose metabolism
    Dvir_GJ12686
Enzymes [BR:dvi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Dvir_GJ12686
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 363 aa AA seqDB search
MVHVTEDVFAEAAVNPFTKETGTIRRFTLSNDEQMSVQILTLGATISSIKVPDSQGQVED
VTLGFDDLAGYESEQNPYMGATVGRVCNRIANGRFVLDGKTIEVSRNRGQLQLHGGFVGF
NKAHWQVLEVLPNGVWLTHTNPDGHEGYPGEVTATVRFTLTEDNCLHVCMDAVTSKATPV
NLTNHSYFNLAGHKAGQAGLYEHTIAINAYGITETDADSIPTGKILPVDGGKFDLRIASN
LGERLRQLEPARGYDDNFCVKFTPPANITSIARVVHPPSGRWLEIASNQPGVQLYTSNFL
PNQAQGESPLPGKAGAAYAKHGAFCLETQKFPDSVNHENFPTTILRPGEKYHHEVIYKFG
KQR
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggtgcacgtcacggaagatgtctttgccgaggctgcagtgaatccattcaccaaggaa
acgggcacgattcgacgctttacgctgagcaacgatgagcagatgtccgtgcagatacta
acgctgggcgccacgatcagcagcattaaggtgccggattctcaaggtcaggtggaggac
gtgacgctcggatttgatgatttggcgggctatgagagcgaacagaatccctatatgggt
gccaccgtagggcgcgtctgcaatcgcatagccaatggccgattcgtgctggacggcaag
acaattgaggtcagccgcaaccggggtcaattgcagctgcacgggggcttcgtgggcttc
aacaaggcgcactggcaagtgctggaggtgctgcccaatggcgtctggctgacgcacacc
aatcccgatggccacgaaggctatcccggcgaggtgaccgccacggtgcgcttcacgctc
accgaggacaactgcctgcatgtgtgcatggatgcggtgaccagcaaagcgacgcccgtg
aatctcaccaatcattcctacttcaatctggccgggcacaaggctggccaagccggactc
tacgagcatacaattgccataaatgcctatggcattaccgaaacggacgcggattccata
cccacgggcaaaattctgcccgtagacggcggcaaatttgatttacggatcgccagcaac
ctgggcgaacgtctacggcagctggagccggcccgtggctatgatgacaacttttgcgta
aagtttacgccgccagcgaacatcacgagcattgcgagagttgtgcatccgccgagcggt
cgctggctagagattgccagcaatcagccgggagtacagttgtatacctccaactttttg
cccaaccaggcgcagggggagagtccgctgccgggcaaagcgggcgcggcctatgccaaa
catggcgccttctgtctggagacgcaaaagtttcccgattcggtgaatcatgagaatttc
cccacaacaatattgcgccccggcgagaagtatcatcacgaagtaatctacaagtttgga
aagcagcgttaa

DBGET integrated database retrieval system