KEGG   Drosophila virilis: Dvir_GJ12691Help
Entry
Dvir_GJ12691      CDS       T01066                                 

Definition
(RefSeq) GJ12691 gene product from transcript GJ12691-RA (EC:2.7.1.30)
  KO
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
dvi  Drosophila virilis
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Dvir_GJ12691
Enzymes [BR:dvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Dvir_GJ12691
Exosome [BR:dvi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dvir_GJ12691
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 531 aa AA seqDB search
METGEGNMAGPFIGAIDEGTTSARFMIFRAGTDDIVCYHQIEVPSIYVKEGWCEQDPRVI
TNTVNECIEGACQKLVALGGKIEDILAIGITNQRESTLVWDRHTGEALGNAIIWLDNRTT
STVEELLETIPNNARNINYLRPLCGLPLSPYFSGVKLRWLRDNVATVRRAMDAGDAMFGT
IDTWLMYNLTGGVNGGVHKTDVTNASRTMLMNIETLQWDANLLKFFGLPNSILPEICSSA
EHFGTIAGGVLRGISITADLGDQQAALVGQQCLVKGQAKATYGTGCFLLYNTGPSIVHSQ
HGLLTTVGYQLGRKATPYYALEGSVSIAGAAFNWLRDNIGLIQNTAQIESMASQVDSSLD
VYFVPAFNGLYAPYWNQDARGVLCGLSEETTSEHIVRATLEAVCFQVRDILDSMHKDCKI
PLAKLMVDGGMTVNNLFLQLQSDLVGIHVLRAKIAETTALGAAMAAYKTVAPQYNMEGPL
SKSEEREAVKPKINSTERNLRYQKWKMAIERSLNWETSTLAQGERESFDGA
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccggcgagggaaacatggcggggccatttattggcgccattgatgagggcacg
acctcggcgcgctttatgatattccgtgcgggcaccgatgacatcgtctgctaccatcag
atcgaggtgccctccatttacgtcaaggagggctggtgcgagcaggatccgcgcgtcatt
accaacactgtcaacgagtgcatcgaaggcgcctgccaaaagctcgtcgcgctgggcggc
aaaattgaggacattttggctattggcattaccaatcagcgtgagtccactttggtctgg
gatcgccacacgggcgaggcgctgggcaatgccatcatttggctggacaatcggaccaca
agcactgtggaggaattgctagaaacgataccgaacaatgcgcggaacattaactatttg
cggccactgtgcggcttgccgctatcgccgtacttctccggcgtaaagctgcgctggctg
cgcgacaatgtggccacggtgcgcagggccatggacgcgggcgacgccatgtttggcacc
atcgacacctggctgatgtacaatctgacgggtggagtgaatggcggggtgcacaagacg
gacgtgacaaatgcgtcgcgcaccatgcttatgaacatcgagacgctgcaatgggatgcc
aatctgttaaagttctttggcctgcccaatagcatactgccggagatctgctcgagcgcc
gagcactttggcacgattgcgggcggcgtgctgcggggcatcagcattacggcggatctg
ggtgatcagcaggcggcgctggtgggtcagcagtgtctggtcaagggccaggccaaagcc
acatacggcaccggctgctttttgctctacaatacgggcccatccatagtgcactcacag
cacggcctgctgaccaccgtgggctatcagctgggacgcaaggcgacgccctactatgcg
ctggaaggcagcgtctctatagctggtgccgccttcaattggctgcgcgacaacattgga
ctcattcagaatacggcccagattgagtccatggccagccaggtggacagctcgttggat
gtgtactttgtgcccgcattcaatgggctgtatgcgccctactggaatcaggatgcacgc
ggcgtgctctgcggcctcagcgaggagacgaccagtgagcatattgtccgcgctacgctg
gaggcggtttgcttccaagtgcgagacatactcgactccatgcacaaggactgcaaaatt
ccgctggccaagctgatggtcgatggcggcatgaccgtcaacaatctgttcctgcagctg
cagtccgatctcgtcggcattcatgtgctgcgcgccaagattgcagagaccacagcgctg
ggcgctgctatggccgcctacaagacggtggcgccgcagtacaacatggaggggccactc
tccaagtcggaggagcgcgaggccgtcaagccgaaaataaattccacggagcgtaattta
cgctaccagaaatggaaaatggccattgagcgttccctgaactgggagacgtccacactg
gcccaaggcgagcgcgaatcctttgatggtgcctaa

DBGET integrated database retrieval system