KEGG   Drosophila virilis: Dvir_GJ12705Help
Entry
Dvir_GJ12705      CDS       T01066                                 

Definition
GJ12705 gene product from transcript GJ12705-RA
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
dvi  Drosophila virilis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 828 aa AA seqDB search
MEELRKHLSKVNVPCGNPPIYKDECVFSYDNPETPTGLYVCLQSFLGFGEAYVQEYAAKT
GNVVFLHIKRERKLKAGESHDEKLKAASEEAEAGPERKITRLAIGVEGGYNETDLAKKYE
IKDTYSIVVAPHLDKKLPYPDADLPLRVTQCVQAILEADSAIAKLEKATLTGTWDGEVRQ
ASKYAENLQQLDNGKKIPPAGWQCEKCDLTNNLWLNLTDGSILCGRKFFDGSGGNDHAVE
HYRQTGYPLAVKLGTITADGKSDVFSYPEDDMVLDPHLSKHLSHFGINMAAMQKCEKSMV
ELELEINQRIGEWSALTESESELQPVAGPGFTGMRNLGNSCYINSVMQVLFVIPDFQQRF
VGSGAEHYFKAYPSDPANDFNIQMAKLGNGLQSGKYSSIAANTLDMEHMTGISPAMFKNI
VGKNHPEFSTKQQQDANDFYLHLLTLLDRNSRNQFNPADALKFQLEDRVECMASRKVKYK
MREEYSFRLPIPLDQATNLDEVREYQERQQAAQASGQRLLDRDLVRHKVPLQACLERFFG
TELIEQFYSTAINGKTTAKKTTRMASMPDFLMIHLGKFTLGDDWVPKKLDVSVDMPDELD
LGVWRSRGGPQAGEELLPEPAAETPKFVFDEHVMSELLNMGFPQEACKRACFHTKNSGLE
AASNWLMEHIADPDISDPFEVPNTRIGDGAAAAAAHFAANPESLAMLMSMGFDERQAVAA
LKATDGNVERATDWIFSHAEGGIDDVPIAAPACTTAAAAASTSNYRDGTGKYKLVAFISH
MGTSAQVGHYVCHIRKQGEWVIYNDTKVAKSQNPPKDLGYLYLYMRDE
NT seq 2487 nt NT seq  +upstreamnt  +downstreamnt
atggaggagctacgcaagcatttatccaaggtaaacgtgccctgcggcaatccaccgatc
tacaaagacgaatgcgtcttctcctacgataatccggaaacgccgaccggactctacgtg
tgtctgcaaagttttctgggctttggggaggcgtacgtacaggaatatgccgccaaaacc
ggcaatgtggtgtttttacacattaagcgggagcgcaaactgaaggcgggcgagtcgcat
gacgagaaactgaaggccgcctcggaggaggccgaggccgggccggagcgcaaaatcaca
cgcctggcgattggcgtcgagggcggatacaatgagactgacttggctaagaagtacgag
atcaaggacacgtacagcattgtcgtggcaccgcatctggacaaaaagctgccctacccg
gatgcggacctgccgctgcgcgtcacacaatgcgtgcaggccatactggaggcggactcg
gccattgccaagttggagaaggccacgctcacaggcacgtgggatggcgaggtacgtcag
gcatcgaagtatgccgagaatctgcagcagctggacaacggcaagaagataccgccagcg
ggctggcaatgcgagaaatgtgatctgaccaacaatttgtggctaaatctaacggatggc
tccatactgtgcggtcggaagttctttgacgggagcggcggcaatgatcacgccgtcgag
cattatcgccagacgggctatccgctggccgtcaagctgggcaccattacggcggacggt
aaatcggatgtcttctcctatccggaggacgatatggtattggatccgcatttgagcaag
catctgtcacactttggcatcaacatggccgccatgcaaaagtgcgaaaagtccatggtc
gagctggagctggagataaatcagcgcatcggcgagtggtccgcgctgacggagagcgag
agcgaactgcagccggtggccggacccggttttacgggcatgcgcaatctgggcaattcg
tgctatatcaacagcgtgatgcaggtgctctttgttattcccgatttccagcagcgcttc
gttggcagcggtgccgagcactattttaaggcgtatcccagcgatccggccaacgatttc
aacatacaaatggccaagctgggcaatgggctgcagtcgggcaagtacagcagtattgcg
gcgaatacactggatatggagcatatgacgggcatatcgccggccatgttcaagaatatt
gtgggcaagaatcatccggaatttagcaccaagcagcaacaggatgccaacgatttctat
ttgcatttgctcaccctgctcgatcggaattcgcgcaatcaattcaatcccgccgatgcg
ctcaagttccagctggaggatcgtgtcgaatgcatggccagtcgcaaggtcaagtacaag
atgcgcgaggagtacagcttccggctgcccataccgctggatcaggcgaccaatttggac
gaggtgcgcgagtatcaggagcgacagcaggcggcacaggccagtggccagcgtctgttg
gatcgtgatctcgtgcggcacaaggtgccgctgcaggcttgcctggaacgcttctttggc
accgagctcatcgaacagttctattcgacggccatcaatggcaagaccacggccaagaag
accacacgcatggccagcatgcccgactttctgatgatccatttgggcaaatttacgctg
ggcgacgattgggtgcccaagaaactggacgtgtcggtggacatgcccgatgaactggat
ctaggcgtttggcgttccagaggcgggccgcaagccggcgaggagctgctgccggagcca
gctgccgagacgcccaaattcgtattcgacgagcatgtcatgtccgagctgttgaacatg
ggctttccgcaggaggcctgcaaacgcgcctgtttccataccaaaaatagcggattggag
gctgcttccaattggcttatggagcacattgccgatccggatatatcggatccgtttgag
gtgcccaacacacgcattggcgacggcgccgccgccgccgccgcccattttgctgccaat
cccgaaagcctggccatgctcatgagcatgggctttgacgagcgccaggcggtcgccgct
ctaaaagccacagatggcaacgtggaacgtgccaccgactggatattctcccatgccgaa
ggcggcatcgatgatgtgccaatcgctgcgcccgcatgcaccacggccgccgctgccgca
tccacgagcaattatcgcgacggcaccggcaaatacaagctggtcgcgttcatctcgcac
atgggcacctccgcccaggtgggccactatgtctgccacatacgtaaacagggcgagtgg
gtcatctacaacgacaccaaggtggccaagtcacagaatccgcccaaagatctgggctat
ctttacttgtatatgcgcgacgagtag

DBGET integrated database retrieval system