KEGG   Drosophila virilis: Dvir_GJ12718Help
Entry
Dvir_GJ12718      CDS       T01066                                 

Definition
(RefSeq) GJ12718 gene product from transcript GJ12718-RA (EC:2.4.1.-)
  KO
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
dvi  Drosophila virilis
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dvir_GJ12718
   00053 Ascorbate and aldarate metabolism
    Dvir_GJ12718
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    Dvir_GJ12718
   00860 Porphyrin and chlorophyll metabolism
    Dvir_GJ12718
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dvir_GJ12718
   00982 Drug metabolism - cytochrome P450
    Dvir_GJ12718
   00983 Drug metabolism - other enzymes
    Dvir_GJ12718
Enzymes [BR:dvi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     Dvir_GJ12718
Glycosyltransferases [BR:dvi01003]
 Others
  Hydrophobic molecule
   Dvir_GJ12718
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 534 aa AA seqDB search
MASATNRILLLAIVAAVFISGSQSANILGVFTSLSPSHLIVQMSMVKVLAENGHNVTVVT
ILKPPITHKAINVVQVPLSDEDQRMMSATIGKMVASDNSNMVISMFRVMGQMKLMFEKMR
DAMMDQRVKNLYENKDNKFDLVMIGYFLNNYQLGIAHKLKVPVILAATMPPNQLFNKMLG
NPQLDSHVPALPGISVKGQPMTFSQRLKNYITTCAMGIFMWILENNDAKDYKKVFGDDPN
MPPYEDLAKNVSLTFFSSHAPSEGPIRPNVPGIVEVGGIQIKDKPDELPKTIADFLSDAK
DGAILLCLGSNVKGAHLKPDTVQNMFNVLSKLKQRVIWKWENLYKTPGKSDNILYSKWLP
QDDILAHPKIKLFITHAGKGGITEAQYHGKPMLALPVFGDQPDNAEKMVKDGFGLSLSLA
TLEEQPFHETIVQVLNNPQYAQKVQTFSSLYRDRPISAHESVLYWTEYVLRYNGAPHLQS
PLVHMNYISANNLDVYALLITILFVFIYVSKVILTKLYRKLFGKAQKTKKIKKS
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atggccagtgctactaatcgcattctgctactcgcaattgttgccgctgtttttatcagc
ggcagccaaagcgccaatatattgggcgtttttacgagtctgagtccatcgcatttgatt
gtacaaatgtccatggtcaaggtgctggcggagaacgggcacaatgtgactgtggttaca
atactgaagccgcccattacacacaaagctataaatgtggtgcaggtgcccctctccgat
gaggatcaacgtatgatgagcgcaaccataggcaaaatggtagccagcgataacagcaac
atggtcatttctatgttccgggttatgggccaaatgaagttaatgtttgagaagatgaga
gatgccatgatggaccagcgagtgaagaacttatatgaaaacaaggacaacaagttcgat
ttggttatgattggctacttcttgaacaactatcagcttggcattgcccataagctgaag
gtgccagtgatattagcagccactatgccaccaaatcaattgtttaataaaatgctgggc
aatcctcagttggattcacatgtgccggcactgcctggaatcagtgtaaaaggtcagcca
atgacattctcacagcgattaaaaaactatataacaacctgcgctatgggtattttcatg
tggattttggaaaacaatgatgccaaagattataaaaaagtgtttggcgatgatccaaac
atgcccccctatgaagatctggctaagaacgtttcgcttacattctttagttcgcatgcc
cccagcgagggtcccatcagacccaatgtgccgggaatagtagaggtgggcggcattcaa
attaaagataaaccagatgaattgccaaaaacaattgccgatttcctgagcgacgccaaa
gatggcgccatcctcctttgccttggctccaatgtaaagggtgctcacttgaaacccgac
acagtccagaacatgttcaatgttctgtccaaactcaagcagagagtcatttggaaatgg
gaaaatctctataagacacctggcaaatcagataatatactctattctaagtggctgcca
caagatgacattctggctcatcccaagattaagctctttataactcacgcaggtaaaggc
ggcatcacagaggcccagtatcatggaaagcccatgctggcgctgcctgtgtttggcgat
cagcctgacaatgctgaaaagatggtcaaagatgggtttggactcagcttgagtttagca
acactggaagagcagcctttccatgagactattgtgcaggtcttgaataaccctcagtac
gcacagaaagtacagaccttttcctccctttatcgcgatcgaccaatctctgcccatgag
agtgtgctctattggactgagtatgttctgcgttataatggtgcacctcatttgcagagt
ccgttggtacacatgaattacatatcagccaataatttggatgtttatgcgctgttaatt
actatcttattcgtatttatttatgtaagtaaagtaattttgactaagttatatagaaaa
ctgttcggtaaagcgcagaaaactaaaaaaataaaaaaatcttaa

DBGET integrated database retrieval system