KEGG   Drosophila virilis: Dvir_GJ12759Help
Entry
Dvir_GJ12759      CDS       T01066                                 

Definition
GJ12759 gene product from transcript GJ12759-RA
Orthology
K09585  
thioredoxin domain-containing protein 10 [EC:5.3.4.1]
Organism
dvi  Drosophila virilis
Brite
Enzymes [BR:dvi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Dvir_GJ12759
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 429 aa AA seqDB search
MYASFWSLCLALLFLLVLGTPAISSRVLELSDRFIDVRHEGQWLVMFYAPWCGYCKKTEP
IFALIAQALHATNVRVGRLDCTKYPAAAREFKVRGYPTIMFIKGNMEFVYNGDRSKDELV
DYALRMSGPPVQLVTRTDSVDMLKGSHTIFFMFVGPQQGIVWDTYYAAAEGYQEHGFFYA
TSEDIAAQHFDFEQLPAVIVYKEEQHHFYPHGHVAHEMDPNDVNETIFQWVNVERFTLFP
KVTRFNIHQLLKTKKFLVLAVVQEDKLSQIATHELEFRDMVEGVIRKHRPRYHDKFQFGW
IGEPSIAHSIILDQLPTPHLIALNSTTQHHYLPEDDPLQMTPQALHLFLESIGNESATAY
GGDTYFVRVNRALFELKRSLREMWRGNPVLMTVIFGLPLGFLSLIMYSIFCGDCLVTEEE
QDEDHEKKE
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgtacgcatctttctggagcttgtgtctggcattgttgttcctgctggtgctcggcaca
ccggccatatcgtcgcgtgtcctggagctgagcgatcgcttcatcgacgtacgccatgag
ggccaatggctggtcatgttttatgcaccgtggtgcggctattgcaagaaaacggagccg
atctttgcgctcatcgcgcaggctctgcacgcgaccaatgtgcgtgtgggtcggctggat
tgcaccaaatatccggcagctgccagggaattcaaggtgcgcggctatccgaccataatg
ttcatcaagggcaacatggagttcgtttataatggggatcgcagcaaggacgagctggtc
gactatgcgctgcgcatgtccgggccaccggtgcagctggtcacgcgcacggacagcgtg
gatatgctgaagggctcgcacacgatcttctttatgtttgtggggccgcagcagggcatt
gtctgggacacatactatgccgccgccgagggctatcaggagcacggcttcttctatgcg
accagcgaggatattgccgcacagcattttgatttcgagcaattgcctgcggtgattgtg
tataaggaggaacagcatcatttctatccacacggtcatgtggcgcacgaaatggatccg
aacgatgtcaatgaaaccattttccagtgggtcaatgtggagcgctttacgctcttcccg
aaggtgacgcgtttcaatatccatcagctgctcaagaccaaaaagttcctggtgctcgcc
gtcgtccaggaggacaaactcagtcagatagccacacatgagctggagtttcgtgacatg
gtcgagggcgttatacgcaagcatcgtccgcgctatcacgataaattccagttcggctgg
attggcgaaccgtcgatagcacattccattatattggaccaattgcccacgccccatttg
atagcgttgaactcgacgacgcagcatcattatctgcccgaggacgatccgctgcagatg
acgccgcaggctctccacctattcctcgagtccatcggcaatgagagcgccacagcctac
ggcggcgacacctatttcgtgcgcgtcaatcgggcgctcttcgagctgaagcgttccctg
cgcgagatgtggcgcggcaatcccgtgctaatgaccgtcatctttggcctgccgctgggc
tttctatcgctgatcatgtactcgattttctgtggcgactgtctggtcaccgaggaggag
caggacgaggatcacgagaagaaggagtaa

DBGET integrated database retrieval system