KEGG   Drosophila virilis: Dvir_GJ12806Help
Entry
Dvir_GJ12806      CDS       T01066                                 

Definition
GJ12806 gene product from transcript GJ12806-RA
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
dvi  Drosophila virilis
Brite
Enzymes [BR:dvi01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     Dvir_GJ12806
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 685 aa AA seqDB search
MASEQPPIDGVAAAAAAAVAAGGDEPFLGLLDIALLAVLIGGAAFYFLRSRKKEEEPARS
YSIQPTTVSTTTATDNSFIKKLKTSGRSLVVFYGSQTGTGEEFAGRLAKEGIRYRLKGMV
ADPEECDMEELLQLKDIENSLAVFCLATYGEGDPTDNAMEFYEWITNGDVDLTGLNYAVF
GLGNKTYEHYNKVAIYVDKRLEELGANRVFELGLGDDDANIEDDFITWKDRFWPAVCDHF
GIEGSGEEVLIRQYRLLEQPDVQPDRIYSGEIARLHSMQNQRPPFDAKNPFLAPIRVNRE
LHKGGGRSCMHIELNIEGSKMRYDAGDHVAMYPINDKSLVEKLGQLCKADLDTVFSLINT
DTDSSKKHPFPCPTTYRTALTHYLEITAIPRTHILKELAEYCTDESEKQMLRSMASLTPE
GKEKYQSWIQDACRNVVHILEDIKSCKPPLDHVCELLPRLQPRYYSISSSAKLHPTDVHV
TAVLVEYKTPTGRVNKGVATTYLKHKQPKDGAEEVKVPVFIRKSQFRLPTKPETPIIMVG
PGTGLAPFRGFIQERQHLRDEGKTVGESVLYFGCRKRSEDYIYEAELEEWAKKGTLTLKT
AFSRDQAKKIYVQHLLEQDADLIWDVIGEKKGHFYICGDAKNMAVDVRNILTKILSTKGN
MSEADAVQYLKKMEAQKRYSADVWS
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atggccagtgagcagccaccaattgatggagtagcagctgctgccgctgccgctgtcgct
gccggcggcgatgagccattcctcggcctgctggatatcgcgctgctggcggtgctgatc
ggcggcgcggccttttactttttgcgcagccgcaagaaggaggaggagcccgcacgcagc
tactccatacagcccaccacagtgagcacgaccacggcgacggataattcgtttatcaag
aaactgaagacctccggtcgcagtctggtcgtcttttatggctcgcagacgggcacgggc
gaggaattcgccggacgtttggccaaagaaggcatcaggtatcggctcaagggcatggtg
gccgatcccgaggaatgcgatatggaggaactgctgcagctcaaggatatcgagaactca
ttggccgtcttttgtttggccacctacggcgagggcgatcccaccgataacgccatggag
ttctacgaatggatcaccaatggcgacgttgacctaacgggcctgaactatgcggtcttt
ggcctaggcaacaaaacctacgagcactacaacaaagtggctatctatgttgacaagcgt
ctagaggagcttggcgccaaccgcgtcttcgagctgggtctgggcgatgacgatgccaac
attgaggatgacttcatcacgtggaaggatcgcttctggcccgccgtctgtgatcacttt
ggcattgagggcagcggtgaggaggtgctgatacgccagtatcgtttgctcgaacagccc
gatgtgcagccggatcgcatttacagcggcgaaattgcgcgtctgcattccatgcaaaat
cagcggccaccgtttgatgctaagaatccattcctggctcccatacgcgtcaatcgtgag
ctgcacaagggcggcggtcgctcgtgcatgcacatcgagcttaatattgagggctccaag
atgcgctacgatgccggcgatcatgtggccatgtatcccatcaatgacaagtcgctcgta
gagaaactcggtcagttgtgcaaggctgacttggatacggtgttctcgttgatcaacacc
gatacggacagcagcaagaagcatccattcccctgccccaccacctatcgcactgcgctg
acgcactatttggaaataactgctattccgcgcacacacatactcaaggagctggccgag
tactgcaccgacgagtccgaaaagcaaatgctgcgcagcatggcctccctgacgccggag
ggcaaggagaagtaccagagctggatacaggatgcctgtcgcaatgtggtgcacatactg
gaagatatcaagtcctgtaagccgcctctagatcatgtgtgtgagctgttgccacgccta
cagccgcgttactattccatttcgtcgtcggccaagctacatccaactgatgtgcatgta
actgctgtgctggtcgaatataaaacgcccacgggtcgtgttaataagggcgtggccacc
acatatctaaagcacaaacagcccaaggatggcgccgaggaggtcaaggtgccggtgttc
atacgcaaatcacagttccgactgcccactaagccggagacgcccatcattatggtgggt
ccgggcaccggcttggcgcccttccgtggcttcatccaggagcgccagcatttgcgtgat
gagggcaaaacagtcggcgagtcggtgctttactttggctgccgcaagcgcagcgaagac
tacatctacgaggcggagctcgaggagtgggccaaaaagggcacgctcaccctgaagacg
gccttctcacgcgaccaggcgaagaagatttatgtgcagcacttgctggaacaggatgcg
gatctaatatgggatgtgattggtgaaaaaaagggacacttttacatctgcggcgatgcc
aagaacatggccgtggacgttagaaatattctaacgaaaattctgtccacaaagggcaac
atgagtgaggcggatgctgtccagtatctgaaaaagatggaggcccagaaacgctactcg
gccgatgtgtggagctaa

DBGET integrated database retrieval system