KEGG   Drosophila virilis: Dvir_GJ12810Help
Entry
Dvir_GJ12810      CDS       T01066                                 

Definition
GJ12810 gene product from transcript GJ12810-RA
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
dvi  Drosophila virilis
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Dvir_GJ12810
Enzymes [BR:dvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Dvir_GJ12810
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 223 aa AA seqDB search
MISFLFIVNRAFSGTSSTLMSQAGSGPRPLVLCGPSGSGKSTLLKRLFAEFPDKFGFSVS
HTTRHPREGEQHGVHYYFVSRSDMERAIANDEFIETAEFTGNMYGTSKQAVRDIQSQGRV
CILDIEQKGVEQIKKTDLNPILIFNNPPTIAELERRLLKRNSETAETLQKRLKAAEMEIA
YGLTPGNFHKIINNVDIDVAYMEFRDFVVDELKKQQALGVHFN
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgataagctttctgttcattgtgaatcgcgcgttcagcggcaccagcagcacgttaatg
tcgcaagcaggttctggcccacgtccacttgtgctctgcggaccctccggttccggcaag
agcacattgctcaagcgtctatttgcggaatttccggacaaatttggcttcagcgtgtcg
cacacaacgcgccatccacgcgaaggcgaacagcatggcgtacattattatttcgtgagt
cgttcggacatggaacgggccattgccaatgatgagttcattgaaacggccgaatttacg
ggcaacatgtacggcaccagcaaacaggctgtgcgcgacatacagagccagggacgtgtg
tgcatactggacatcgaacagaagggcgtggagcagatcaagaaaaccgatctcaatccc
atactgatcttcaacaatccaccgaccatcgccgaactggagcgccgtctgcttaaacgc
aacagcgaaacggcggagacgctgcagaaacgcctcaaggcggccgagatggagattgcc
tatggcctgacgcccggtaactttcacaagatcatcaacaatgtggacatcgatgtcgcc
tacatggagttccgtgactttgtcgtcgatgagctcaaaaagcagcaggctttgggcgta
cactttaattag

DBGET integrated database retrieval system