KEGG   Drosophila virilis: Dvir_GJ12810Help
Entry
Dvir_GJ12810      CDS       T01066                                 

Definition
(RefSeq) uncharacterized protein
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
dvi  Drosophila virilis
Pathway
dvi00230  Purine metabolism
dvi01100  Metabolic pathways
Module
dvi_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Dvir_GJ12810
Enzymes [BR:dvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Dvir_GJ12810
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_16 AAA_22 ATPase_2 RsgA_GTPase ABC_tran RNA_helicase MMR_HSR1 AAA_18 AAA_29 AAA_5 Mg_chelatase NACHT Pox_A32 cobW AAA_28 NTPase_1 AAA_17 AAA_24 AAA_21 AAA AAA_30 Rad17 T2SSE AAA_14 MobB Roc
Motif
Other DBs
NCBI-GeneID: 6624158
NCBI-ProteinID: XP_002046276
FlyBase: FBgn0200045
UniProt: B4LB54
Position
Unknown
AA seq 223 aa AA seqDB search
MISFLFIVNRAFSGTSSTLMSQAGSGPRPLVLCGPSGSGKSTLLKRLFAEFPDKFGFSVS
HTTRHPREGEQHGVHYYFVSRSDMERAIANDEFIETAEFTGNMYGTSKQAVRDIQSQGRV
CILDIEQKGVEQIKKTDLNPILIFNNPPTIAELERRLLKRNSETAETLQKRLKAAEMEIA
YGLTPGNFHKIINNVDIDVAYMEFRDFVVDELKKQQALGVHFN
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgataagctttctgttcattgtgaatcgcgcgttcagcggcaccagcagcacgttaatg
tcgcaagcaggttctggcccacgtccacttgtgctctgcggaccctccggttccggcaag
agcacattgctcaagcgtctatttgcggaatttccggacaaatttggcttcagcgtgtcg
cacacaacgcgccatccacgcgaaggcgaacagcatggcgtacattattatttcgtgagt
cgttcggacatggaacgggccattgccaatgatgagttcattgaaacggccgaatttacg
ggcaacatgtacggcaccagcaaacaggctgtgcgcgacatacagagccagggacgtgtg
tgcatactggacatcgaacagaagggcgtggagcagatcaagaaaaccgatctcaatccc
atactgatcttcaacaatccaccgaccatcgccgaactggagcgccgtctgcttaaacgc
aacagcgaaacggcggagacgctgcagaaacgcctcaaggcggccgagatggagattgcc
tatggcctgacgcccggtaactttcacaagatcatcaacaatgtggacatcgatgtcgcc
tacatggagttccgtgactttgtcgtcgatgagctcaaaaagcagcaggctttgggcgta
cactttaattag

DBGET integrated database retrieval system