KEGG   Drosophila virilis: Dvir_GJ12858Help
Entry
Dvir_GJ12858      CDS       T01066                                 

Definition
(RefSeq) GJ12858 gene product from transcript GJ12858-RB (EC:1.11.1.9)
  KO
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
dvi  Drosophila virilis
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Dvir_GJ12858
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Dvir_GJ12858
Enzymes [BR:dvi01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Dvir_GJ12858
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 247 aa AA seqDB search
MTDNTDTHIQSITRRTFRCFKLPATTTTTTRNFGIAAIQMNQCPRYCVVLLPLVAVVSSV
NCSADLATKSQYSTAAALDMSNGDYKNAASIYEFTVKDTHGNDVSLDKYKGRVVLIVNIA
SKCGLTKNNYQKLTDLKEKYGERGLTILNFPCNQFNSQMPEADGEAMVCHLRDSKADIGE
LFAKVDVNGDNAAPLYKYLKAKQTGTLGSGIKWNFTKFLVNKEGIPINRYAPTTDPMDIA
KDIEKLL
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgactgataatacagatacacacattcaaagcattacacggcgaacattcaggtgcttc
aaattgccagcaacaacaacaacaacaactcgtaattttggtatagctgcaattcaaatg
aatcagtgtcctcgctattgtgttgtccttttgccattggtcgccgttgtcagcagtgtt
aattgcagcgcggatttggcaacgaagtcccaatactcgacagcagctgccctcgacatg
tctaacggcgattacaagaatgcagcgtccatttacgagtttaccgtgaaggacacgcac
ggcaacgatgtctcgctggacaagtacaagggtcgcgttgtgctcatagtcaacattgcc
tccaagtgcggtttgaccaagaacaactatcagaagctgacagatttgaaggagaagtac
ggtgaacgcggcctgaccattctgaatttcccctgcaaccagttcaactcccaaatgcca
gaggccgatggcgaggccatggtttgccatctgcgcgactccaaggcagacattggcgag
ctcttcgccaaggttgatgttaatggcgataacgccgcaccgctctacaagtatctgaag
gccaagcagactggaactttgggcagcggcatcaaatggaatttcaccaagtttttggtg
aacaaagagggcatcccaattaatcgctatgcacccaccaccgatcccatggacatagcc
aaggatattgagaaattattgtag

DBGET integrated database retrieval system