KEGG   Drosophila virilis: Dvir_GJ12858Help
Entry
Dvir_GJ12858      CDS       T01066                                 

Definition
GJ12858 gene product from transcript GJ12858-RA
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
dvi  Drosophila virilis
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Dvir_GJ12858
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Dvir_GJ12858
Enzymes [BR:dvi01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Dvir_GJ12858
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 244 aa AA seqDB search
MNFRHIQSITRRTFRCFKLPATTTTTTRNFGIAAIQMNQCPRYCVVLLPLVAVVSSVNCS
ADLATKSQYSTAAALDMSNGDYKNAASIYEFTVKDTHGNDVSLDKYKGRVVLIVNIASKC
GLTKNNYQKLTDLKEKYGERGLTILNFPCNQFNSQMPEADGEAMVCHLRDSKADIGELFA
KVDVNGDNAAPLYKYLKAKQTGTLGSGIKWNFTKFLVNKEGIPINRYAPTTDPMDIAKDI
EKLL
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgaatttcagacacattcaaagcattacacggcgaacattcaggtgcttcaaattgcca
gcaacaacaacaacaacaactcgtaattttggtatagctgcaattcaaatgaatcagtgt
cctcgctattgtgttgtccttttgccattggtcgccgttgtcagcagtgttaattgcagc
gcggatttggcaacgaagtcccaatactcgacagcagctgccctcgacatgtctaacggc
gattacaagaatgcagcgtccatttacgagtttaccgtgaaggacacgcacggcaacgat
gtctcgctggacaagtacaagggtcgcgttgtgctcatagtcaacattgcctccaagtgc
ggtttgaccaagaacaactatcagaagctgacagatttgaaggagaagtacggtgaacgc
ggcctgaccattctgaatttcccctgcaaccagttcaactcccaaatgccagaggccgat
ggcgaggccatggtttgccatctgcgcgactccaaggcagacattggcgagctcttcgcc
aaggttgatgttaatggcgataacgccgcaccgctctacaagtatctgaaggccaagcag
actggaactttgggcagcggcatcaaatggaatttcaccaagtttttggtgaacaaagag
ggcatcccaattaatcgctatgcacccaccaccgatcccatggacatagccaaggatatt
gagaaattattgtag

DBGET integrated database retrieval system