KEGG   Drosophila virilis: Dvir_GJ12896Help
Entry
Dvir_GJ12896      CDS       T01066                                 

Definition
(RefSeq) uncharacterized protein
  KO
K13915  lysozyme C [EC:3.2.1.17]
Organism
dvi  Drosophila virilis
Brite
Enzymes [BR:dvi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     Dvir_GJ12896
Exosome [BR:dvi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dvir_GJ12896
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lys Transglycosylas SLT
Motif
Other DBs
NCBI-GeneID: 6622553
NCBI-ProteinID: XP_002046434
FlyBase: FBgn0200131
UniProt: B4LCD1
Position
Unknown
AA seq 149 aa AA seqDB search
WDISFLRFNHEGFIVLVALAFAAPALGRTMDRCSLAREMSDLGVPRDQLNKWTCIAEHES
NYRTGVVGPENSDGSNDYGIFQINDLYWCQPPNGRFSYNECALSCNDLLTDDITNDVRCA
QKVLSQQGWSAWSTWHYCNGYLPSIDDCF
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
tgggacatcagttttctgaggtttaatcatgaaggcttcattgttttggttgctctggct
tttgccgcccccgctctcggtcgcaccatggaccgttgctccctggcccgcgagatgtcc
gacttgggcgttcctcgtgaccagctgaacaagtggacgtgcattgccgagcacgagagc
aactaccgcaccggcgtggtgggccctgagaactcggacggctccaacgactacggcatc
ttccagatcaatgacttgtactggtgccagcctcccaacggtcgcttctcctacaacgag
tgcgccttgagctgcaacgacctgttgaccgatgacatcaccaacgacgtccgttgcgcc
cagaaggtgctcagccagcagggctggtccgcctggtccacctggcactactgtaacggc
tatctgccctccatcgatgactgcttctaa

DBGET integrated database retrieval system