KEGG   Drosophila virilis: Dvir_GJ12985Help
Entry
Dvir_GJ12985      CDS       T01066                                 

Definition
GJ12985 gene product from transcript GJ12985-RA
Orthology
K11310  
general transcription factor 3C polypeptide 4 [EC:2.3.1.48]
Organism
dvi  Drosophila virilis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 679 aa AA seqDB search
MSFQLLSKSDLRQETVHDFVAYTTDGDCISLLGSKTELLTLELNSKSNPQLPFPYVVASW
KCANKKRPLDQLSLQVNLQNIYESSNVLEMQQLSLEPAYTAVCSQDVPLPNWLAAKLSTQ
PLPNGQMLLATLNSYGALHLLCKSSEQPLWRQHEKGLNVTATLRDTLQPPYEVPAVKIST
FRQYQAFVDRSWITMFAWRPVDSGSYMLVLGTAAGSIWTLTLCANAATVLDHCELQTLLG
RICFMQIYEDLLLVGDNNGLVHLYRFGTATEETEEGLSLVKTLWLRPDHMGLQEALITYC
PNRDCYYIACCKAAHLLIWCMPKHEEGDWLETRLHAGGMKITGLCALENCNYALVTARGQ
LYHIELSHKHGQLCASMRWIRVDDAENYQPVGLCCSPSQNLLTILYTRSKEFLLNKTVTR
HMLHVRVGRIHNSQALVQLERRINPGQPINSCRDLLVDIRLEIFQGVQLEEFVNYAPFDM
IAFDDLATEAQQHQLQLKYHILDALIQMQRHQRNQTLLEQFEQELQLLLAMLALTHMRLR
LQFLTSLQTELTAFQRQSAQCQLAESARIRQQLEQRQLQREQAPQAAIKRFLAQMEVHFE
QLQLKLNVPETAQMYDASDQQLCTVSYVQVLPTLERHYCTLCGRLALLERQLLLELYAPG
GVLLCPCCHGSYTLELLDA
NT seq 2040 nt NT seq  +upstreamnt  +downstreamnt
atgtcattccaactgttgtccaagagtgatctcaggcaggagaccgtccatgactttgtg
gcctacacaacggatggcgattgtatttcgctgctcgggtcgaagacggagctgcttacc
ctggaattgaacagcaagtcgaacccgcagctgccctttccctacgttgtggccagctgg
aagtgtgcgaacaagaagcgaccactggaccagctgtcgctgcaggtgaatcttcagaat
atctacgagagcagcaatgtgctggagatgcaacagctcagcctggagccggcttacacg
gccgtttgctcgcaggatgtgccgctgcccaattggctggccgccaaattgtcaacccag
ccgctgcccaatggccaaatgctgttggccacattaaacagctatggagcgctgcatttg
ctgtgcaaaagttcagagcagccgctttggcggcagcacgagaagggtctcaacgtgacc
gcaactctgcgggatacactgcagccgccatacgaagtgcccgccgtcaagatcagcacg
ttccggcaatatcaggcatttgtggatcgcagctggataaccatgtttgcgtggcgtcca
gtggacagcggcagctatatgctcgtcctgggcacagctgccggcagcatatggacgctg
accctgtgcgccaatgcagccactgtcctggaccattgcgagctgcagacgctcctgggt
cgcatttgttttatgcaaatctacgaggatctgctgcttgtgggcgacaacaacggcctg
gtgcatctgtacagatttggcacagcgacagaggagacggaggagggtcttagtctggtg
aaaacgctatggctgcgcccggatcacatgggcctgcaggaggcacttattacatactgt
ccgaatcgcgactgctactatatagcctgctgcaaggcggcgcatcttctgatctggtgc
atgcccaagcatgaggagggcgactggctggagacgcgtctgcatgcaggtggcatgaag
atcacgggtctgtgcgctctggagaactgcaactatgcgctggtcacggcacgtgggcaa
ctatatcacatcgagctcagccacaagcacggtcagctgtgcgccagtatgcggtggatt
cgtgtggacgatgccgagaactaccagccagttggcctgtgctgcagtcccagccagaat
ctgctgaccattctgtacacgcgcagcaaggagtttctgctcaacaagacggtgacccgc
catatgctgcacgtgcgcgtgggcagaatccataatagccaggcgctggtgcagctcgaa
cgtcgcatcaatcccggtcaacccatcaacagctgtcgagatctgttggtggacatacgt
ctggaaatctttcaaggtgtccagctggaggagtttgttaactatgcgccattcgatatg
attgccttcgacgatctggccaccgaggcccagcagcatcagctgcagctcaagtaccac
atcttggatgcgctcattcagatgcagcgacatcaacgcaaccaaacactgctcgagcaa
ttcgagcaggaactgcagctgctgttggctatgctggcccttacgcatatgcgactgcgt
ctccagttcctgaccagcctgcagacggagctgacggcattccagcgccagtcggcacaa
tgtcagctggcggagagtgcgcgcatcaggcagcagttggaacagcggcagctgcaacgg
gagcaggcgccccaagcagcaataaaacgttttctggcccagatggaggtgcacttcgag
cagcttcagctgaaactgaatgtgccggaaacagcacaaatgtatgatgcgtccgatcaa
cagctttgcaccgtctcctatgtacaggtgctgcccacgctggagcggcactattgcaca
ctgtgcggacggctggctctgctggaacggcagctgctcctggagctctatgcgccgggc
ggtgtactgctgtgtccctgctgtcatggatcctacaccttggagctgttggatgcataa

DBGET integrated database retrieval system