KEGG   Drosophila virilis: Dvir_GJ13123Help
Entry
Dvir_GJ13123      CDS       T01066                                 

Definition
GJ13123 gene product from transcript GJ13123-RA
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
dvi  Drosophila virilis
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Dvir_GJ13123
Enzymes [BR:dvi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Dvir_GJ13123
Exosome [BR:dvi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dvir_GJ13123
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 521 aa AA seqDB search
MMRAFWLTLSIQVAFSYCQYIYGPDPTWNIRSTNDLKSKDFWFHDAQRTLYDKLTTLPNQ
YLAKNIIFFLGDGMSVPTVTAGRIYDGQQKGIIGERNRLEFEKFDYVGLSKTYCVDKQVS
DSACTASAYLSGVKANYHTIGVSADVQLNDCAGAKLPQNRLSSIAAWALRGRKSAGLVTT
TRVTHASPAGVYAHTSNRDFESDLDVRDLGQNPSNCPDIAQQLLDEMGQGLRVVLGGGIK
KFLPNTMKDVYGNVGERLDGRNLIDEWQQSKAGNARVVFNRTDLLNNNPYDTDYLLGLFN
ASHLAYNLDDSIDTPSLEEMTEAAIGVLSGNPAGYFLFVEGGRIDHAHHETKAKKAVDET
VQFSNAVRKARQLTNPWETLIVVSADHGHTMTINGYPDINNNITGLNSELSDVDNLPYAT
LSYANGPDYQRFYKSVNGTVERVDLRTLNIGDRNERYPHGVPMSEETHGGGDVAVYANGP
WAHLFSGVYEQSTLPHLMGFAACIGPGITYCDLRPKKTYNP
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgtgctttctggttaacgctctcgattcaagttgctttcagctattgtcagtac
atttatgggccagatcccacatggaatattcgctctacaaacgatcttaagagcaaggat
ttctggtttcacgatgcccagcgcacgctctacgacaagctgacgacgctgcccaaccag
tatttggccaagaatataatcttcttcctgggcgatggcatgtccgtgccgactgtcaca
gccgggcgcatctatgatggacagcagaagggcatcataggcgaacggaatcgcctggaa
tttgaaaagttcgactacgtgggactatcaaaaacatactgcgtcgacaaacaagtttct
gactcggcctgcaccgcctccgcctatctgtccggcgtaaaggccaattatcacacgatc
ggcgtctcagccgatgtacagttaaatgactgtgccggagcgaaattaccccaaaatcgc
ctttcctccattgcagcctgggcgctgcgcggacgcaagtctgcgggcctggtgacgaca
acgcgcgtaacccatgcaagtccggctggagtttatgcacacacatcgaatcgcgacttt
gagagcgatttggatgtaagggatctgggccagaatcccagcaactgtcctgacattgcg
cagcagctgttggatgaaatgggtcaaggcttgagggttgtattgggtggcggcatcaag
aaatttctgcccaatacaatgaaagacgtgtatggcaacgtgggcgagcggctggatgga
cgtaatctaatagatgaatggcaacagagcaaagctggcaatgcacgggttgtctttaac
cgcacggatctgctcaacaacaatccctacgatacggactacttattgggcttattcaat
gcctcacatctggcttataatttggatgatagcatagataccccgtcgctcgaggagatg
accgaagctgcaatcggagtgctgtcgggcaatccagctgggtactttctatttgtcgaa
ggtggtcgcatcgatcatgcccaccacgagaccaaggctaagaaggccgtggacgaaaca
gtacaattctcaaatgcagttaggaaagcgcgccaactgaccaatccttgggaaactctg
attgttgttagcgccgatcatggacatactatgaccattaatggctaccccgatataaac
aacaacattaccggtcttaactcagaattaagcgatgtagacaatttgccgtacgccact
ttatcttacgccaacggcccggactaccaaaggttctataagtcagtaaatggcacagtt
gaacgagttgatctccgtacgctgaacattggtgataggaacgaaaggtatccacatggc
gttcccatgtctgaggaaactcacgggggtggtgacgttgctgtatatgctaatggtcct
tgggcgcatttgttcagcggcgtttacgaacaaagcacattacctcatctaatgggtttt
gctgcatgcattggaccaggaataacatattgcgatcttcggcccaagaaaacttacaat
ccttaa

DBGET integrated database retrieval system