KEGG   Drosophila virilis: Dvir_GJ13183Help
Entry
Dvir_GJ13183      CDS       T01066                                 

Definition
GJ13183 gene product from transcript GJ13183-RA
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
dvi  Drosophila virilis
Pathway
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    Dvir_GJ13183
Protein phosphatases and associated proteins [BR:dvi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     Dvir_GJ13183
Ubiquitin system [BR:dvi04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     Dvir_GJ13183
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 926 aa AA seqDB search
MMIQEPVQAAIWHCLNHYDHKDAVFLAERLCSEVESDETIFLLATSYYRSNRLDQAYWLL
LEKSRRSPQCRYLQAKCAYELKKYAEAESALISSGFVDNKHFDEVQREFGEIACFAYQLM
AQICMRTERQKLAVNALRRALKLNPFMWHAFADLCLLGQETDTAAIFQIQSTDVFNTCQG
SSANANSMVLFGGSAVNEQQQQLENLLLNNVSNNSNYILSTPVEQQQQHQQQLQQQNNNG
SSLATLQNLMTPNNNINNNNNNNLNSSITMLRGGVQQQSTNTNSSMMLLEDTPMGYAAHD
APAQQQQQLAQHQHQLYDANNGTPFRKQFKYLSAISPLTPSFGIMPLTSPCDGGSAVLQA
NLNLSAYSPLPQMLVEVNQEPKIIGKKFKTHVGGLINRQEKSKPAVFTQAGNITPRTPNN
VVGNGPPNPNAAVRRSSRLFSNSAYSVKENNKSPNITNNNKFVQPRSPPRKTKSSRMTKI
CLNNELIEEKTHHHLAEKLSEKQSRKEKEKVETITSGATAGGNSQSTINNRSAEEAKVLL
NNSLNNAQTLAHQLLSMKKQSADGLMLLLRDLAEGYKLLSAFQCKAAIMHLEGTIPKHHL
SSSWVQSLIGMCRYELRDYEAAVLIFKRIHETEPCRLDYMEIYSTSLWHLQKEVALSALA
QDLIAQDKRSPVTWCVAGNCFSLHKEHETAIKFFKRAVQVDPDFVYSYTLLGHELVLTEE
FDKAMDYFRAAVVRDPRHYNAWFGIGTIYSKQEKYELAELHYVKALKINTQNSVILVHIG
AMQFFMQKKDLALQTLNTAATIDPKNPLARFHRGSIYFSLGKYQEALRELEELKEIVPKE
SVVFYLIGKIHKTLGNMDLALMHFSWATDLDPKGANNQIKDAFDSMAHPNCCPPNDNALD
VDFDPTSERSDDSTQAQQDVSYDSDY
NT seq 2781 nt NT seq  +upstreamnt  +downstreamnt
atgatgatacaagagcccgtgcaggccgccatatggcactgcctcaaccactacgatcat
aaggatgctgtttttctcgcggagcgcctctgctcagaagtggaaagcgacgagacaata
tttttgttggccaccagctattatcgttcaaatcgattggatcaggcctattggctgctc
ctggagaagtcgcgccgctcgccgcaatgccgctacttgcaggcgaaatgcgcttacgag
ctgaagaaatatgcggaagcagaaagtgctctgatttccagcggttttgtggacaacaaa
cactttgatgaggtgcagcgcgagttcggcgaaatcgcctgctttgcctatcaattaatg
gcacagatctgtatgcgaacggagcgccagaagttggcggtgaacgcgttacgtcgcgcc
ctcaaactgaatccgtttatgtggcatgcgtttgccgatctgtgcctgctgggtcaggaa
acggatacagcggcaatattccaaattcaaagcactgatgtgttcaacacttgccagggc
agcagcgccaatgccaattccatggtgctgttcggcggcagcgctgttaacgagcagcaa
cagcagctggaaaacctgctgcttaacaatgtaagcaataactccaattatatactaagc
accccagtggagcagcagcagcaacatcagcagcaactgcagcagcagaacaacaacggc
agcagcttggccacgctacagaatctgatgacgccaaacaacaatatcaacaacaacaac
aataacaatctcaatagctccattacaatgctgcgtggcggcgtccaacaacagagcacc
aacaccaactcgagcatgatgctactagaggacacacccatgggttatgcagcgcatgat
gcgcccgcacagcaacagcagcagctggcgcagcatcaacatcaattgtatgatgccaac
aatggcacaccatttcgaaagcaattcaaatatctgtctgcaatatcgccgttaacgccc
agctttggcattatgccgctgactagtccctgcgatggcggctcagctgtgctgcaggca
aatttaaacctgtccgcgtattcaccattgccacaaatgctggtcgaggtcaatcaggag
ccaaaaatcattgggaaaaaatttaagacgcatgtgggcggacttatcaatcgtcaggag
aaaagtaaacccgccgtttttacgcaggctggcaacataactccgcgcacgccaaacaac
gtggttggcaatggacccccgaatcccaatgcggcagtgcgtcgcagctcgcggctgttc
agcaattcggcgtactctgtcaaggagaacaacaaatcgcccaatataacgaacaataac
aaatttgtacagccgcgatcgccaccacgcaaaaccaaatcgtcacgcatgaccaaaata
tgtttaaacaacgaactaattgaggagaagacgcatcaccatctcgccgagaagctgagc
gaaaagcagtcgcgcaaggaaaaagaaaaagtggaaacaatcacatcgggcgcaacagcc
ggtggcaacagtcaatcaacaatcaataatcgcagcgccgaagaagccaaagtcctgcta
aacaacagcctcaacaatgcccagacgctggcgcatcagctgctgagcatgaagaagcaa
tcggcggacggtctaatgctgctgctgcgcgacctggccgagggctataagctattgtcg
gcgtttcagtgcaaagcggccattatgcatctggaggggacgataccaaagcatcattta
agctccagttgggtgcagtcgctgatcggcatgtgccgctacgagctgcgcgactatgag
gccgccgtgcttatattcaagaggatacacgaaacggagccgtgtcgcttggattacatg
gaaatctattccacatcgttgtggcacttgcagaaggaggtcgctttgtcggcgctcgcc
caggacctcatcgctcaggataaacgtagtccggtgacgtggtgtgtggccggcaattgt
ttctcgctgcacaaggagcacgaaacggcaattaagttctttaaacgtgctgttcaagta
gatccagactttgtgtacagctatacgctcctgggacacgagctggtacttaccgaggag
ttcgacaaggcgatggactattttcgggcagctgtcgtgcgtgatccacggcattataat
gcctggttcggcattggcacaatttactccaagcaggagaaatacgagctggccgagctg
cactatgtgaaggcgctgaaaatcaacacacagaactcggtcatcctggtacacatcgga
gccatgcagttcttcatgcagaaaaaggatctggcactgcaaacgcttaatacggcagct
acgatagatccgaaaaatccgttggcacgctttcatcgaggctccatatatttctcgctg
ggcaaataccaggaggcgttgcgcgaactggaggaactcaaggagattgtgccaaaggag
tcggttgtgttttatctgattggtaaaatacacaagacgttgggcaacatggatctggca
ttgatgcatttcagttgggccaccgatctggatccgaagggcgcaaataatcaaatcaaa
gatgccttcgattcaatggcgcatcccaattgctgtccacccaatgacaatgccctggat
gtggactttgatccaacatcggagcgttccgatgactcaacgcaggcgcagcaggatgtt
agctacgacagcgactactag

DBGET integrated database retrieval system