KEGG   Drosophila virilis: Dvir_GJ13185Help
Entry
Dvir_GJ13185      CDS       T01066                                 

Definition
GJ13185 gene product from transcript GJ13185-RA
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
dvi  Drosophila virilis
Brite
Enzymes [BR:dvi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dvir_GJ13185
Peptidases [BR:dvi01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   Dvir_GJ13185
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 325 aa AA seqDB search
MSEGAGNWCLIESDPGVFTELIREFGCDGAQVEEIWSLDSESFKDLEPIHGLIFLFKWVQ
EDEPVGKVVLDRDHIFFAKQVINNACATQAILSLLLNLNHEDIKLGETLTNFKEFCQCFD
PYNKGLTLSNASQIRTVHNSFARQTLFELDMKNQNKDEDVYHFVGYMPIAGRLYELDGLR
EGPIDLGEIKPEQNWIDVVRPIIEKRMQRYSDGEIHFNLMALISDRQRIYEQQIDKLLNP
AANAMDTAEDRQTEINSLRSYIHFYINCNLLLLQVENVRRKHNYLPFIVELLKMLGETGQ
LLPIYEKAKQRALEREQKMSKKDSN
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaggagcaggcaattggtgtctcatagaaagtgatccgggtgtatttacggag
ctgatacgtgaatttggatgcgatggtgctcaggtggaagaaatctggagcctggacagt
gaatcattcaaggacctggagccaatacatggtctaatatttttgttcaagtgggtgcaa
gaggacgaacctgttggcaaggttgtgttggaccgcgatcatatattctttgccaagcaa
gtaattaacaatgcctgtgcgacacaagccatacttagtttgctgctgaacctgaatcat
gaggacatcaagctaggagaaactttaactaacttcaaagagttctgccagtgcttcgat
ccctacaacaagggccttacgctgagcaatgcctcgcagatacgcaccgtgcacaattcg
tttgcgcgacaaacgctttttgagctggatatgaaaaaccagaacaaggatgaggatgtc
tatcattttgttggctatatgcccattgctggtcgtctgtatgagctggatgggctgcgc
gagggacccatcgatctgggcgagatcaagccggagcagaattggatcgacgtagtcagg
ccgatcattgaaaagcgcatgcagcgatacagtgatggcgaaatacattttaatttaatg
gccctgatctcggatagacagcgcatctatgagcagcaaattgacaagctgctcaatccg
gctgccaatgccatggacacggcggaggatcgtcagactgaaataaatagcctgcgctca
tacatacacttctatattaattgcaatctgttgcttttgcaggtggaaaacgtgcgacgc
aaacacaattatttgccttttattgtggagctactcaaaatgctgggcgagactggacaa
ttgctgcccatctatgagaaggccaagcagcgggcgctagaacgcgagcaaaagatgagc
aaaaaagattccaactag

DBGET integrated database retrieval system