KEGG   Drosophila virilis: Dvir_GJ13192Help
Entry
Dvir_GJ13192      CDS       T01066                                 

Definition
GJ13192 gene product from transcript GJ13192-RA
Orthology
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.4.19.12]
Organism
dvi  Drosophila virilis
Brite
Enzymes [BR:dvi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dvir_GJ13192
Peptidases [BR:dvi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dvir_GJ13192
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1214 aa AA seqDB search
MPVSLAVCETANVVNAALRESLGSGIGGGGGCVAAAASRSSAGSGSGSVAGVDEAKIGDV
SGTDNLQSQIVANAKRVLLAKIEYEEVENYHESVLAKLKSKYIVIKPDNNNGAANCNYKT
NGKAVGSNGHDNNTVNGGTVNGNRKQTVDSGQSNQNSSANPNELPKPKRVLYPRENIRIG
WKQSERKWQVGAGMLNVGNTCYLNSTLQALFHIPALANWLVSETSHVENCNISESCGSGG
CIICAMAKTLQTTQSNQSAVRPFLIYTKLRQICKHMVVGRQEDAHEFLRFLVEAMEKAYL
MRFRNFKELDQLVKETTPISQIFGGYLRSEVRCLSCNHVSITFQHFQDLLLDIRKADTLE
EAFDGYFSRERLEDMGYKCEGCKKKVSATKQFSLERAPITLCIQLKRFSMMGNKLTKQIS
FKPRIDLSRFAARSPTAAAQPLSYRLVSMVTHLGVSQHCGHYTAIGLTEAGSYYNFDDSY
VKPIAMQSVCNTNAYIMFYELDVANSSSSSTINNNSSSSSNNSVAPKLNGLRLSNGAHSP
AAATVAVAATATSTSASAVSPRFIGPQLPNGYANSNGHALGGAKTTIQFKTTPQKQLQQQ
QQQQNGLLMGANKFQESSQSKHSLAGTLHKGEAAPNANTNANANKSSCNNNITSQHQQQH
ILPISSDEDEDEDDSDDDDDDDDDDVKANTAPQLPSMPKMFEDSESVAQTAKLKPKTPLK
SLVPYESASEEEQEQQQQQQQQQLLQTPQQLAANPRKRRSGSDSSESEEEAPPPLPSILR
NGHAKTNGSVSNTSNSSHSKAKSASNASSANVNSSKQKTDAIDEIFKSLNNYKNKHRIAA
DDDEDGDGDGDGHGNEQVQTEQGTKKLNSASSASASKSNGWQSQNGKAPSSPKTPPSPAV
IKSKTGIWQITRTNDDDDEEDEEEDDVEADADQEDDDDEVVVVEEPQVSVTPKNPKNPFA
ASKSAEANATIAGAKRQKLLNGSAKSAATTRPGNGYQSESVANGSAVSELLKQNHRGYGT
SVLSWNGKPSELDKESFDLVCAKRIAGHGDTDVHSDVNSSSNNSSNINSNSNSNSNGNGK
RKNSTLLAEAREQRKRDAEDEEENEMDRGRQRKVKSASVKSNNSTPGYNPFQEFENQKRW
HSNKSGTFPRFYHQNNRPNFQQRNKFKFNRFGGGAKFQQQRALQRHLAAGGGFTRRQQQS
TGQQQQQQQQQQQS
NT seq 3645 nt NT seq  +upstreamnt  +downstreamnt
atgcccgtctcgttggctgtgtgcgaaacagcaaatgtcgtgaacgcagcgctgcgcgaa
tcgcttggcagcggcatcggcggcggcggcggctgcgttgcggccgcagctagccgatct
agtgccgggtccggttctggttctgttgctggcgttgatgaggccaaaatcggcgatgtc
tccggcacggacaatctgcagagtcaaattgtggcaaatgccaagcgtgtcttgctggcc
aaaatcgagtacgaggaggtagagaattaccatgagtcggtgttggccaaactcaaatcc
aaatacattgtcattaagccggacaacaacaatggagctgccaactgcaattacaaaaca
aatggcaaggctgtgggctccaatggacatgacaataatactgtaaacggcggcactgtg
aatggcaatcgtaaacagaccgtggacagtggacagtccaatcagaattccagtgcgaat
ccaaatgaactgcccaagccgaagcgggtgctctatccgcgcgagaatatacgcatcggc
tggaagcagtcggaacgcaaatggcaggtgggcgctggaatgctgaatgtgggcaacact
tgttacctcaactcgacgctgcaggcgctctttcatatacccgcgctggccaattggctc
gtctcggagacgtcgcatgtggagaactgcaacattagcgagtcctgcggcagcggtggc
tgcatcatctgtgcaatggccaaaacgctgcagacaacgcaatccaatcaatcggcggtc
cggccatttcttatctacacgaagctcaggcaaatctgcaagcacatggttgttggccgg
caggaggatgcgcatgagttcttgcgctttctggtcgaggccatggagaaggcgtatctg
atgcgttttcgcaatttcaaagagctcgatcagctggtgaaggagacgacgccaattagt
caaatctttggcggctatctgcgcagcgaggtgcgctgcctcagctgcaatcatgtctcg
attacgtttcaacatttccaagatttgttgctggacatacgcaaggcggacaccctggag
gaggccttcgatggttacttttcacgcgagcggctcgaggacatgggctacaagtgcgag
ggctgcaagaaaaaggtatccgctactaaacagtttagtttggagcgtgctccaatcacg
ctctgcatccagttgaagcgcttctcgatgatgggcaacaagctgaccaaacagattagc
ttcaagccacgcattgacctgagccgattcgcagcacgcagccccacggccgctgcacag
cctttaagctatcgcctcgtctcgatggtcacacatctgggcgtttcgcagcattgtggc
cattacacggccattggcctgacggaggcgggcagctactacaacttcgatgacagctat
gtgaagccaattgccatgcagagcgtctgcaatacgaatgcctacataatgttctacgag
ctggacgtggccaacagcagcagcagcagcactatcaacaacaatagcagcagcagcagc
aacaacagtgttgcgcccaagctgaacggactgcgtctgagcaatggagcgcatagccct
gcggcagctactgtggctgtggcagccactgcgacgtccacatccgcctctgctgtgtct
ccgcgcttcattgggccacagctgccgaatggctatgccaacagcaatggacatgcactt
ggtggtgcaaagacaaccatccagttcaagacgacgccacagaaacagctgcaacagcag
cagcaacagcaaaacggactccttatgggagccaataaatttcaggagtcttcgcaatcg
aagcattcactggctgggacattgcataagggagaagctgctccaaatgcaaatacaaat
gcaaatgctaacaaaagttcctgcaacaacaatataaccagccagcaccagcaacaacat
attctgccaatatcatccgacgaggatgaggacgaggacgacagtgatgatgacgatgat
gatgatgatgatgatgtcaaagccaacacagcgccgcagctgcccagcatgccgaaaatg
tttgaggatagcgagagcgttgcccaaactgccaagttgaagccaaagacgccactcaag
agcctggtgccgtatgagtccgcctccgaggaggagcaggaacagcagcagcaacagcaa
caacagcagctgctgcaaacgccacagcaactggcagcgaatccgcgcaagcgacgcagc
ggctccgattccagtgaatcagaggaggaggcaccgcctccgctgccctcaatactgcgc
aatggacacgccaagaccaatggcagtgtgtccaacacgagcaacagcagccacagcaaa
gccaagtccgcctcaaatgcctcgtcggccaatgttaacagcagcaaacaaaagactgat
gccatagacgagatattcaaaagtctaaacaactacaaaaacaaacatagaatcgcagca
gatgatgatgaggatggggatggagatggagatgggcatgggaatgagcaggtgcaaacg
gaacagggcacaaagaagctaaacagcgcatcctccgcatcggccagcaagagcaacggc
tggcagtcacaaaacggcaaagcgccgtcatctccaaagacgccgccctcgccagcggtc
attaaatccaagactggcatttggcagattacgcgcaccaacgatgacgacgatgaggag
gacgaggaggaggatgatgttgaagccgatgctgatcaggaagatgatgatgatgaagtg
gttgttgtagaagagccacaagtcagtgtcacgcccaaaaatcccaaaaatccatttgcc
gccagcaaatcggccgaggcgaatgcaacaattgccggagctaagcgacagaagctgctc
aacggcagcgccaagtcggcggcgacaacacggcccggcaatggctatcagagtgaatcc
gtggccaacggcagtgccgtcagtgagctgctgaagcagaaccatcgtggctatggcacc
tctgtgctcagctggaacggcaagccatcggagctggacaaggagagttttgatttggtt
tgtgcgaaacggatagctggtcacggcgatacggatgtgcatagcgacgtcaacagtagc
agtaacaatagcagtaacattaacagtaacagcaacagcaacagcaatggcaatggcaaa
cgcaagaactcgacgttgctggccgaggctcgagagcagcgcaagcgggatgcggaggat
gaggaggagaacgaaatggatcgtggacgtcagcgcaaggtcaaatcggcgtcggttaaa
tctaataacagcacgcccggctacaatccattccaggagttcgagaatcagaagcgctgg
cacagcaacaagtctggcacctttccccgcttctatcatcaaaataatcgccccaacttt
cagcagcgcaacaaattcaaattcaatcgatttggcggcggtgccaagttccaacagcag
cgtgccttgcagcgccatctggcggccggcggtggttttacgcgtcgtcaacagcagtcg
acgggtcaacagcagcagcagcaacaacaacaacaacaatcctaa

DBGET integrated database retrieval system