KEGG   Drosophila virilis: Dvir_GJ13278Help
Entry
Dvir_GJ13278      CDS       T01066                                 

Definition
GJ13278 gene product from transcript GJ13278-RA
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
dvi  Drosophila virilis
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Class
Metabolism; Overview; Fatty acid metabolism [PATH:dvi01212]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:dvi00062]
Cellular Processes; Transport and catabolism; Lysosome [PATH:dvi04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 284 aa AA seqDB search
MRIKYLLIVCMYFIGSLAYRPVVIIHGILSGAESMTLLVRHIEKLHPGTVVYNCDKFSGW
YSLENAWWQVEQIRDYIGQIGKLHPEGIIVLGYSQGGLLARAAIQSLPNHNVKTFISLSS
PQAGQYGTSFLHLIFPDLAAKTAFELFYSRVGQHTSVGGYWNDPHKQELYMKYSEFLPLI
NNERLSSNSTSFKMGMERLDKLVLIGGPNDDVITPWQSSHFSYFNESLDVVPFYKRTIYM
NDSIGLKTLLEDERLIIIVKPFVHHLSWHTNKKVINEVIMPYLD
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgcggattaagtacttgctaattgtgtgcatgtactttattggatctctggcatacaga
ccagtagtaataatccatggtatactgtcgggagccgaatctatgacgcttctggtgcga
catatcgagaagctgcatccgggtacagttgtatacaattgtgataagttcagtggttgg
tacagcctggagaatgcctggtggcaagtggaacagatcagggactacataggtcaaatc
ggaaagctacatccagaagggatcatcgtgttaggctactctcagggaggactcttggca
agggcggcaatacaaagtctacccaatcacaatgtgaaaacctttatatcgttatcatca
ccccaagcgggtcaatacggaactagcttcttgcacctaatctttccggatcttgcggcg
aagacggcctttgaactattttactctagggtgggtcaacacacatccgtgggtggctac
tggaacgatccgcataagcaagaattatatatgaaatatagcgaattcttgccattgatt
aataatgagaggttgagctccaattcaacatcatttaaaatgggcatggaacggcttgat
aaactagttctaatcggaggacccaatgatgacgttattacgccttggcagtccagccat
tttagctattttaatgaatcattggatgtggtcccgttttataagcgaacaatatacatg
aatgactccatcggcctgaaaaccttattggaagacgaacgactaataattattgtcaag
ccctttgtgcatcatctctcgtggcacaccaacaagaaagttatcaatgaagttataatg
ccatatctggattga

DBGET integrated database retrieval system