KEGG   Drosophila virilis: Dvir_GJ13418Help
Entry
Dvir_GJ13418      CDS       T01066                                 

Definition
GJ13418 gene product from transcript GJ13418-RA
Orthology
K11857  
ubiquitin carboxyl-terminal hydrolase 47 [EC:3.1.2.15]
Organism
dvi  Drosophila virilis
Brite
Enzymes [BR:dvi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Dvir_GJ13418
Peptidases [BR:dvi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dvir_GJ13418
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1563 aa AA seqDB search
MAEQDSKNSTQCAVFDQTPGSQQKKINIVVRSHFTVKHVIALIGTQFAYGKFELLLQPHG
EKDLVNLNALDKELLYDVPGFEPQLKNNLVLLPEGTWDGNVTKRYELTIKKSASTLSKQA
TTADNMATTTATTTATKTGEKKKRVTTGEKKKKSPSKTKTSVSPTELTAESAATAAAASA
TATPTTPSKVSIKVKTKASDNKNNIVKSKDQVDESVQLPKAPSTCATDIAIDELTKVEIT
EQLKQQLPQNRILISPVDDVAPELFNISPVSEAEQLSDDDLALGASASPTLMGPAYEFGN
AGPTESDLLAGTEAGTDALAAIAGNDKVEEDDRQEMEYSNFFGRKYGGDEVPAWQRINTS
ASEFVASANTETETHRNGVGPRAYVGLVNQAMTCYLNSLLQALYMTPEFRNALYRWEFDN
DNEAKNIPYQLQKLFLNLQTSPKSSVETTDLTRSFGWDSTEAWQQHDIQELCRVMFDALE
HKFKNTKQANLISTLYEGKMNDYVKCLECNTEKTREDTFLDIPLPVRPFGSSSAYGSIEE
ALRAFVQPETLDGNNQYLCEKCKKKCDAHKGLHFKSFPYILTLHLKRFDFDYQTMHRIKL
NDRQAVTFPQKLNLNSFVNRSGQGEQYQMNGSSNADDCSTADSGSAMEEDNLSSGVGTTA
SSSQHENDMNDEDEGIDMSSSTGKSANMEARLKQELLSGPYIYDLFAIMIHSGSASGGHY
YAYIKDFDNDEWFCFNDQNVSTITQEDIQRSFGGPNGSYYSSAYTSSTNAYMLMYRQVDA
KRNELVVKCNDFPEHIKSLLLKLHAEEDTRVSRLGRHITVTDLALPHLYKPRVYFYNPLL
KKLKMTRVYLSQSFDVNKVLMSAYDMLNVEQFAPLSRCRLVAYNSSMDTIIQSLENCTDP
ALTELRSSHNYNLDFLLEYRAEDQQFENYASDGTTWYVFKVDLSTMAMDGPFLVYSAARE
SSDVLRHSIAVRLHINEQQFLLAAVRGTYRMAFVAYDPQPTSEAQQHLQQLANSQFKYIT
YFYLNVPNTDATSLEMLGVPSSEPIAAPIEPANGCAGGDVVDAAMMNGINGTNGTATPEG
VSAGNNDCDWRRYKRDQADSLTTPGHESNSEDSSLSDGDRTLVENSMQHRGGGDSQVSST
SHSPQLSSPEDEAASHDAMMRVHAYCNGNGSYGSEAGDTSSLPPSTTTQFFHAIKIDCVD
LATSSSTTSGHQSDDEAQLRKPTHAYKLLVGKHMRMGTFKRHIEQLIRVPSAYFKLQRKH
ESTISNNQTNTLVFLNEGETLTVEIGKTLQPYEFKSKIYFLRLADLNNETAKLPCVCEWV
YNATTTVEQAKQDLVAKLHRIDAKYSSLTVDNCRIWLKGGRCPTKILANEDTLYCDIRST
AAEFIVQECEEGVVAQPKEDSLTIFVRRWYPDKWEFGKFQEITLDKDGEIKRCLSQICNI
PIDRLSYMKLNSYFPCTSISAVSVNEAVNWLSVPAALDVYPLNTTNSGNMYLYKDKSVPV
RELSSDERRSLTNKEKARLDRLGCISTTRYSQRRERALKIYLDSPEKPSNVTASAPIDAH
AEN
NT seq 4692 nt NT seq  +upstreamnt  +downstreamnt
atggctgagcaggacagcaagaatagtacacagtgcgccgtctttgaccaaacgcctggc
tcacaacaaaagaaaatcaacatcgttgtgcgctcccattttacggtaaagcacgtcatt
gcgctgattggcacacagtttgcctatggcaaattcgagctgctgctacagccgcatggc
gagaaggatctggttaatttgaatgcgctagacaaggagctgctttacgacgtgcctggc
tttgagcctcagctgaagaataacctggtgctgctgccagagggcacctgggacggcaat
gtgaccaaacgctatgagttgaccataaaaaaatccgcttcgactctcagcaaacaggca
actaccgcggacaacatggcaacgacaaccgcaacgacaacagcaacaaaaaccggtgag
aaaaagaagcgggtaacaacaggcgagaaaaagaaaaaatcgccaagcaaaaccaagact
agcgttagtcccactgaattgacagctgagtcagcggcaacagcagcagcagcatcagcc
acagcgacgcccaccacgcccagcaaggtcagcataaaagtgaaaaccaaagccagcgat
aacaagaacaatattgtgaagagcaaggaccaagtggatgaaagcgtgcagctgccaaaa
gcgccaagtacctgcgccacagacatagctattgacgaactaaccaaagttgaaataacc
gagcagctgaagcagcagttgccacaaaacaggatcctcatttcgcccgtcgatgatgta
gctcctgagttatttaatataagtcccgtctcggaagctgaacaactgtctgacgatgat
ttggcattgggcgcctcggccagtcccactttgatgggtccagcctacgaatttggcaac
gccggacccacagaaagcgatctgttggctggaactgaagctggcaccgatgcactagcg
gccatcgctggcaatgataaagtcgaagaggatgatagacaggagatggaatattcaaat
ttctttgggcgcaagtacggcggcgatgaggtgcccgcctggcagcgcatcaataccagc
gcctcagaatttgtggcctcggccaatacagaaacagagacgcaccgaaatggtgttggg
ccacgtgcatatgtgggacttgtcaatcaggctatgacctgctatctaaacagtctgctg
caagcgctttatatgacgcccgagtttcgtaatgccttgtaccgctgggagtttgacaac
gacaacgaggccaagaacataccctaccagttgcagaagctgtttctcaatttgcagaca
tcgccgaaatcatcggtggagacaactgacttgacgcgcagctttggctgggactcaacg
gaggcctggcaacagcatgacatccaagagctgtgccgcgtcatgttcgatgcactggag
cacaagttcaagaacacaaaacaggccaatctcatctcgacgctgtacgagggcaaaatg
aatgattatgtcaagtgtttggagtgcaataccgaaaagacgcgcgaggatacctttctt
gacataccgctaccggtgcgtccatttggtagtagttccgcctacggtagcatcgaggag
gcactgcgcgcctttgttcagcccgaaactctcgatggcaacaatcagtatctgtgcgag
aaatgcaaaaagaaatgcgacgcccacaagggactgcactttaagtccttcccctatata
ctgacgctgcatcttaagcgcttcgactttgactatcagaccatgcatcgcatcaagctg
aatgacaggcaagcggtgaccttcccgcaaaagctgaatctgaacagctttgtgaatcgc
agcggccagggcgagcagtatcagatgaatggcagcagcaatgcagacgattgcagcacc
gcggacagtggctcagccatggaggaggataacttgagcagcggtgtgggaacaacggcc
agttccagtcagcatgagaacgatatgaacgacgaggacgaaggcatcgacatgagcagc
agcacaggcaagagcgcaaacatggaggcacgactcaaacaggagttgctatcaggtcca
tatatctatgacctctttgctatcatgatacactcgggcagcgcatcaggcggtcattac
tatgcttatatcaaggattttgataatgatgaatggttctgtttcaatgatcaaaatgtg
tccacgatcacacaagaggacatccagcgttcatttggcgggcccaatggcagctactat
tcaagtgcttatacgtccagcacgaatgcgtatatgctcatgtatcgccaggtggacgcc
aagcgtaacgagcttgtggtcaagtgtaacgactttccggaacacatcaagtcgctgctt
ctcaagctgcatgcggaggaagatacgcgcgtttcgcgcctgggtagacacatcacagta
acagatctggcactgccgcatctatacaaaccgcgcgtctacttttataatccgttgctc
aagaaactaaagatgacccgcgtgtatctgtcgcagagtttcgatgtgaataaagtgctg
atgtctgcctatgatatgctcaatgtggagcagtttgcgccgctgtcacgctgccgtctg
gttgcctacaattcatccatggacaccatcatacagtcgctggagaattgcactgacccg
gcactaaccgagctgcgttcctcacataactacaatctggactttttgctggagtaccgg
gctgaggatcagcagtttgaaaactatgccagcgatggcactacgtggtatgtgtttaag
gtagatctctcgaccatggcgatggacggtcccttcctggtttattcagcagcgcgggag
tctagcgacgttctgcgccattcaattgcagtacgtttgcacattaacgagcagcagttt
ttgctggccgccgtgcgtggcacttaccgcatggcctttgtagcgtacgatccccaaccg
acatcggaggcacagcaacatcttcagcaactggctaactcacaattcaaatacatcaca
tacttttacttaaacgtgcctaacaccgatgccaccagtctcgagatgttgggcgtgccc
agcagcgagcccattgcagctcccatcgagcccgccaatggctgcgccggtggtgatgta
gtggatgctgccatgatgaatggtattaacggcacaaacggcacggctacgcccgagggt
gtcagcgccggcaataacgactgtgattggcgtcgctataagcgcgatcaggctgattcg
cttacgacacccggccatgaatccaactcagaggatagtagcctgagtgatggtgatcgt
acactggttgagaacagtatgcagcatcgtggcggcggcgatagtcaggtgagctccacc
agccactcaccacagctgtccagtcctgaggatgaggccgcctcacatgacgccatgatg
cgtgttcacgcctattgcaatggcaacggcagctatggcagcgaggcgggcgacaccagc
tccctgccacctagcacaacaacacaatttttccatgccatcaaaattgattgcgtggat
ctggccaccagtagcagcaccaccagtggccaccaatccgatgacgaggcgcaactgcgt
aagcccacacacgcttataagcttcttgtaggcaagcatatgcgtatgggcacctttaag
cggcacatcgagcagttgatacgcgtccccagcgcctattttaagctacagcgaaagcat
gagagcaccatatccaataaccagaccaatacgctggtctttctaaatgaaggcgaaact
ctgaccgtagagatcggtaaaacactgcaaccgtacgagttcaagtctaagatatacttt
ttgcggctggcggatttaaacaatgagaccgccaagctgccctgcgtctgtgagtgggtg
tataatgccaccactacagtggagcaggccaaacaggatctggtcgccaagctgcatcgc
atcgatgccaaatacagctcccttaccgtggacaattgtcgcatctggctaaagggcggt
cggtgtcccactaaaatactcgctaacgaggatacactgtactgcgacattcgctccacg
gctgccgagttcattgtgcaagagtgtgaggagggcgtggtggcgcagccaaaggaagat
tcgttaaccatattcgtgcgtcgctggtatccggataaatgggagtttggcaaattccag
gaaatcacattggacaaggatggcgaaatcaaaagatgtttatcacaaatatgcaacata
cctattgatcgcttgagttatatgaagctaaacagctactttccctgcacaagcatatcg
gcagttagcgttaacgaggccgtcaactggctctctgtgcccgcggcgctggacgtgtat
ccattgaacacaactaacagtggcaacatgtatttgtataaagataaaagcgtgccggtg
cgagagctctcgtcagatgagcgccgctcgttaaccaataaggagaaggcgcgcctggat
cgattgggctgcatttcaacgacacgttactcgcagcggcgcgaacgagccctaaagatc
tacttggactcgccagagaaaccaagcaatgtaactgcctcggcgcccatagacgcacat
gccgagaactaa

DBGET integrated database retrieval system