KEGG   Drosophila virilis: Dvir_GJ13551Help
Entry
Dvir_GJ13551      CDS       T01066                                 

Definition
GJ13551 gene product from transcript GJ13551-RA
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
dvi  Drosophila virilis
Pathway
Amino sugar and nucleotide sugar metabolism
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:dvi00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 316 aa AA seqDB search
MARLIESNFVPIAVGVVAVVAGALIVHYFINKKSTKPRREPNRTARLRTLVDPNDKYQLP
LIEKEVLSHDTRRFRFGLPSKQHILGLPVGQHIHLIATIDNELVIRPYTPISSDEDVGYV
DLVVKVYFKDTHPKFPAGGKMTQHLEQMELGEKISFRGPSGRLQYLGNGTFSIKKLRKDP
PKHVTAKRVNMIAGGTGITPMLQLVREVLKRSDKDKTKLALLFANQSEKDILLREELDEL
AKKHPDQFKVWYTVDKAAEGWTYSVGFINDEMIGAHLLPANDETIVLLCGPPPMINFACN
PALDKLGYHPDTRFAY
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgtttaattgagagcaatttcgttccgattgccgtgggcgtcgtagccgtcgtt
gccggcgccctgattgtccactatttcatcaacaagaagtcaacgaagccgcgccgtgag
ccgaaccggaccgcgcgactgcgcacacttgtggatcccaacgataagtatcagctgccg
ttgatcgagaaggaggtgctcagccatgatacgcgacgtttccgctttggactgccctcc
aagcagcatatactcggcctgcccgtgggccagcacatacatctgattgcaacgattgac
aacgagcttgtcatacggccgtatacgcccatctcgtctgacgaggatgtgggctatgtg
gacttggttgtgaaggtgtactttaaggatacgcatcccaaattcccagctggtggcaaa
atgacccagcatttggaacagatggagctgggcgagaagatatcgttccgtggaccatcg
ggtcgcctgcagtacctgggcaacggcaccttctccattaagaaactgcgcaaagatcca
cccaaacatgtgaccgccaagcgtgtcaacatgatagccggcggcactggcatcacgccc
atgttgcagctggtgcgcgaagtgctcaagcgcagcgacaaggacaagaccaaactggcg
ctgctgttcgccaaccagagcgaaaaggatattttgctgcgtgaggaactggatgaactg
gccaagaagcatcccgatcagtttaaggtctggtacaccgtggacaaagcggccgaaggc
tggacgtacagtgttggatttatcaatgatgaaatgattggagctcatctgctgccggcc
aacgatgagacgattgtactgctgtgcggaccaccgcccatgattaactttgcctgcaat
ccagcgttagacaagcttggctatcatccggacacacgttttgcgtattag

DBGET integrated database retrieval system