KEGG   Drosophila virilis: Dvir_GJ13812Help
Entry
Dvir_GJ13812      CDS       T01066                                 

Definition
GJ13812 gene product from transcript GJ13812-RA
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
dvi  Drosophila virilis
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    Dvir_GJ13812
Enzymes [BR:dvi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dvir_GJ13812
Transcription machinery [BR:dvi03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     Dvir_GJ13812
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 809 aa AA seqDB search
MSGGPAITLKSQPIDGSNSNSGNAAGQQQQSGNNAAAASSSSSQGSGGTVPPAQEGTRQN
SLQRIQQRKQKVFNLPEAQKLAKLSMYSACQAEGCRCTGWKTPQENRHRDVESSYCPELS
EECRNASCRHPLRSHISHLTEISRTSMDDLLGAIIDMENLFMSMQRVEDEDTKKVYLYLF
RLLRQCVLTRQQAVIRGPLGDPPFESPCISKAVLSLVFYKYNHLNPTELQTMTEVAKTFL
NFLNHYNFESPSVRRSDATLTHEDASTYKINYTRWLVFCHVPAFCNSLRQFETSLVFGRT
LLRTVFQYMSQQLKKKCISERDRFPEDKRSIITQMPKFLEALRAELLKDDSPIWDSSYRP
PNSFVMQQRKRHQEVAPPATISSAGAASAPSSSKRSSVGEPAHKRAKKEPVERVPSENLD
DLPTDVVLRAMKSVSESKTTNKAEILFPVNVSRDENVKAEEQKRAIEFHVVGNSLTKPVD
KQTILWLLGLQLVFAHQLPEMPREYISQLVFDTKHKTLALIKENQPIGGICFRPFPTQGF
TEIVFCAVTMAEQVKGYGTHLMNHLKDYSIQRGIKHLLTFADCDAIGYFKKQGFSKDIKL
ARPVYAGYIKEYDSATLMHCELHPSIVNTQFIAVIRNQSEILKELIAQRHNEVQKVRPGL
TCFKEGLPSIPVESIPGLREIGWKPQMRPVRASRPLEESTDPEKLANSFQSVLQSVRQHA
TAWPFLRPVTAAEVPDYYDHIKYPMDLKTMGERLKKGYYQTRRLFMADMARIFSNCRFYN
SPDTEYYRCANSLERYFQTKMRELGLWDK
NT seq 2430 nt NT seq  +upstreamnt  +downstreamnt
atgtctggtggtccggcaataacgctgaaaagccaaccaatagatggaagcaatagcaat
agtggaaatgccgctggccaacaacagcaatcggggaataacgccgcggcagcgtcttcc
tcctcgtcacagggctcgggtggaactgtgccaccagcccaggagggcacacgccaaaac
agcttgcagcgtatacagcagcgaaagcagaaggtattcaatctgccagaggcacaaaaa
ctggctaaattatcaatgtattctgcgtgccaagccgagggctgccgttgcactggatgg
aagacgccacaggagaacaggcatcgagatgtcgagtcgtcctactgtccggagctgagt
gaagagtgtcgcaacgctagttgccgtcatccgctgcggtctcacatctctcatctaact
gagatctcaaggacaagcatggacgacctcttgggcgcaatcatcgatatggaaaaccta
tttatgtccatgcagcgcgtagaggacgaggacactaaaaaagtgtatttgtatttgttt
aggctgctccgtcaatgcgtcctaacacgccagcaggctgttattcgaggtcccttggga
gatcctccattcgagtcgccgtgcatttcgaaggccgtattgtccttggttttctataag
tacaaccacttgaacccgactgagctgcagaccatgacggaggtggccaagacattccta
aacttcctcaaccattacaactttgagtcgccttcggtacgccgtagcgatgccactttg
actcacgaggacgcctcaacctataagatcaattatacgcgctggcttgtgttttgccat
gtgcccgccttttgtaactccttgcggcagttcgaaacatctttggtatttggacgaact
cttctgcgaactgtgtttcaatatatgtcgcagcagctgaaaaagaagtgtatttctgag
cgtgatcgctttcccgaagacaagaggtcgatcatcacgcaaatgccaaagttcttggaa
gcattgagagccgaattgctgaaagatgattcgcccatatgggattccagttataggcca
ccaaattcatttgtcatgcaacaaagaaagcgtcatcaggaagtggcacccccagcgacc
atttcaagtgctggtgccgcatctgctccgagcagtagtaaacgctcaagcgttggagaa
ccagcccataagagggccaaaaaagagcctgtcgaacgggttcccagcgagaatttagat
gaccttccaaccgatgtagttttgcgagccatgaaatccgtttcggagtcgaaaaccaca
aataaagctgaaattttgtttcccgtcaatgtgtcgcgcgatgaaaatgtgaaggccgaa
gagcagaagcgcgccatagagttccatgttgtgggcaattcgctaacaaagcccgtggat
aagcagacaatcctttggcttctgggactgcagcttgtgtttgcgcatcagttgcccgaa
atgccacgtgaatacataagccagctggtttttgacaccaagcacaagaccttggcgcta
atcaaggagaaccaaccaattggaggaatatgcttccgcccatttcccacccagggcttc
acagagattgtattctgcgcggtcacaatggcggaacaagtgaagggatacggcacacat
ctgatgaatcacttaaaggattacagcatacagcgtggcattaagcatctacttacgttt
gccgattgtgatgccatagggtattttaagaaacaagggttttccaaggacatcaaactg
gcacgtcccgtctatgcgggatatatcaaggaatatgacagcgccacgcttatgcactgt
gagctgcatccaagtattgtgaatactcaatttattgctgttattcggaatcaaagtgag
atcctgaaggagctcattgctcagcgacacaatgaggtccaaaaagttaggcctggctta
acatgcttcaaagagggattgccatctataccagttgaatctataccgggtctaagagaa
atcggctggaaaccgcaaatgcgtccagtgcgtgcctcccgtcccttggaagaatctact
gatccggaaaaactggccaattcttttcaatccgtattacaatctgtgcgccaacacgcc
acagcatggccattcctacgacctgtcactgcagccgaagttcccgactactacgatcac
atcaaataccccatggacttgaagacaatgggcgaacgtctgaaaaaaggttattatcaa
acacgtcgcttgtttatggcagatatggcacgtattttctcaaattgtcgcttctacaat
tctcccgacactgagtattatcgctgcgccaattcgctcgaacgttatttccaaaccaaa
atgcgagaactgggcttatgggacaaatga

DBGET integrated database retrieval system