KEGG   Drosophila virilis: Dvir_GJ13832Help
Entry
Dvir_GJ13832      CDS       T01066                                 

Definition
GJ13832 gene product from transcript GJ13832-RA
Orthology
K03259  
translation initiation factor 4E
Organism
dvi  Drosophila virilis
Pathway
RNA transport
mTOR signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dvir_GJ13832
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    Dvir_GJ13832
Translation factors [BR:dvi03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    Dvir_GJ13832
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 272 aa AA seqDB search
MQSDFHRMKNFANPKTMFKSSAVPAGNEQANASANTVAPGRPEPTPTATVAAADAAAAAT
AAPEVAGNKEEPKAATESQQSDDGAVRTEHLFKHPLQNTWTLWYLENDRTKSWEDMQNEI
TSFDTVEDFWSLYNHIKPPSEIKLGSDYSLFKKGIRPMWEDAANKQGGRWVITLNKSSKN
DLDNLWLDVLLCLIGEAFDHSDQICGAVVNIRGKSNKISIWTANGNNEEAALEIGHKLRD
ALRLGRQNLLQYQLHKDTMVKQGSSVKSIYNL
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgcagagcgactttcacagaatgaagaattttgccaatcccaagaccatgttcaaaagc
agcgctgtgcctgctggcaacgagcaggcgaacgctagcgcaaacacagtggcaccgggt
cgcccggagccaacaccgactgccactgttgctgctgctgatgctgctgctgctgctact
gctgctcccgaggtggctggaaacaaggaggagccaaaggccgccaccgagtcgcagcag
tcggatgatggtgctgtgcgcaccgagcatttgtttaaacacccgctgcaaaacacatgg
acactgtggtatttggaaaacgatcgcaccaaatcctgggaggacatgcaaaacgaaatt
accagctttgacacagtcgaggacttctggagtctatacaatcacatcaagccgccatcc
gagatcaaattgggtagtgattattcacttttcaagaagggcatacgccccatgtgggag
gatgctgccaataagcagggtggtcgctgggtgatcacactgaacaaaagctctaagaac
gatttggacaacttgtggctcgatgtgctgctttgtttgattggcgaggcattcgatcac
tcggatcagatttgcggcgctgttgtcaatattcgcggcaagagcaacaagatatccatc
tggactgccaatggcaacaacgaggaggccgctttagaaattggacacaagctgcgcgat
gctctacgtctggggcgccaaaatttgcttcaataccagctgcacaaggacaccatggtc
aagcagggatcgagtgtcaaatcgatctataatttgtaa

DBGET integrated database retrieval system