KEGG   Drosophila virilis: Dvir_GJ13873Help
Entry
Dvir_GJ13873      CDS       T01066                                 

Definition
GJ13873 gene product from transcript GJ13873-RA
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
dvi  Drosophila virilis
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Dvir_GJ13873
Enzymes [BR:dvi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Dvir_GJ13873
Peptidases [BR:dvi01002]
 Cysteine Peptidases
  Family C44
   Dvir_GJ13873
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 559 aa AA seqDB search
MCGILAIFSPDGRAIQAQSVHSLRELAYRQSGKQRHRGPDDTGVLVIAEQGVALVHERLA
VIGVETGHQPLQSRDGNISLIANGEIYNYVELARQIATRLPGYQPKSDSNVIIELYEEHG
AELLQHIRGMFSFVLYDRRRRQLLVARDPLGIIPLYMGHDAAGNIWFASEMKCLTGVCQQ
LGIFPPGHVAAGTVEQLQQLQPVRYYKPSWRRVMPTRQVQLQELRAQLELAVRTHLQCDV
PFGALLSGGVDSSLIAAIAARIMRERNAGHKLRTFSVGMHGSPDFEHAHLVAQHIGSQHE
EIAFSVEDCLDGVRDLIYHLESYDVATVRCSLPMFYLARHIKSTGIKMILSGEGADEIFG
GYLYFHKAPNYEQFHEEMVTRCEQLHVSDILRANKVTMSKGLELRVPFLDTSLVDHVMSI
RPQDKIPGPLNEYLGQRKWRMEKFVLRQAFAGDYLPDAVLWRQKEQFSDGVGYALIDALP
EFAARHVSDAQLLAAQERFPINPPKTKEAFYYRCIFEEQFPGEAAANTVEKWAPRLDWGC
PEDPSGRAQTAHDQAYGKC
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcattttggccatattctcgccggacggccgagcgatccaggcgcagagcgtg
cacagcctgcgggagctggcgtatcgtcagagcggcaagcaaaggcatcgcggtccggac
gacaccggcgtcctggttatagccgagcagggcgtggctctggtgcacgagcgtctggct
gtgatcggcgtggagacgggtcaccagccgctgcagtcccgcgacggcaacatctcgctg
atagccaacggcgagatatacaactatgtggagctggcccggcagattgccacacggctg
cccggttatcagccgaagagcgacagcaatgtgatcatcgagctgtacgaggagcacggc
gccgagctgctgcagcacatcaggggcatgttcagctttgtgctgtacgatcgccgacgt
cggcagctgctggtggcacgcgatcctctgggcatcataccgctctatatgggccacgat
gcggcgggcaacatctggttcgcctcggaaatgaagtgcctgacgggcgtctgccagcag
ctgggcatctttccgcccggccatgtggccgcgggcactgtggagcaactgcagcagctg
cagccggtgcgctattacaagcccagctggagacgtgtgatgcccacgcggcaggtgcag
ctgcaggagctgcgtgctcagctggagctggccgtgcgcacgcatctgcagtgtgatgtg
cccttcggggcgctgctgtcgggcggcgtggactccagcctgatagccgccattgcggcc
aggataatgagagaacggaatgccgggcacaagctgcgcaccttctcggtgggcatgcac
ggctcgccggacttcgagcatgcgcacctggtggcccagcacattggcagccagcacgag
gagatcgcgttcagtgtggaggactgcctggacggtgtgcgcgatctgatctatcatctg
gagtcctacgatgtggccaccgtgcgctgcagtctgcccatgttctatctggccaggcac
atcaagagtacgggcatcaagatgatactctccggcgagggcgcagacgaaatatttggg
ggctatttgtacttccacaaggcgcccaactatgagcagttccacgaggagatggtcaca
cgctgcgagcagctgcatgtctccgacatactgcgcgccaacaaggtgaccatgtccaag
ggcctggagctgcgcgtacccttcctggacaccagcctggtggatcatgtgatgagcata
cggccgcaggacaagataccgggtccactgaacgagtacctgggccagcgcaagtggcgc
atggagaagttcgtgctgcgccaggcattcgccggcgactatctgccggatgccgtgctc
tggcgccagaaggagcagttctcggatggcgtcggctatgccctcatcgatgccttgccc
gagtttgcggctcgccatgtcagcgatgcccagctgctggcggcgcaggaacgctttccc
atcaatccacccaagaccaaggaggccttctactatcgctgcatctttgaggaacagttt
ccgggcgaagcagctgccaacaccgtagagaagtgggcgccacgtctggactggggctgt
ccagaggatccctccggacgagcacaaacggcacacgaccaggcctatggaaagtgttag

DBGET integrated database retrieval system