KEGG   Drosophila virilis: Dvir_GJ13874Help
Entry
Dvir_GJ13874      CDS       T01066                                 

Definition
GJ13874 gene product from transcript GJ13874-RA
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
dvi  Drosophila virilis
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:dvi00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 559 aa AA seqDB search
MCGIFAIFSSDGRPIETQCFQGSKHSLRELAYRQSGRQRHRGPDSTGVVVIPEQGVAMVH
ERLRIVGVEMGDQPFVSDSGDLVLVANGEIYNYLELSAQIAKRRSGYKPKSDCHVILELY
QDYGLELLQHITGMYAFALYDKRSKELLLARDPFGIIPMYIGEDAAGNVWIASELKCLAA
CCDRVETFTPGEARFGRVGAMRRWRHFEQPWQKQLPSLPCDLSLLRASLESAVRTHLHCD
VHFGALLSGGVDSSLIASIATKIMRETNPSYRLKTFSVGLRNAPDFEAARQVAKYIDSEH
TELIFEIDEALDGIRDIVYHLETYDVTTVRCSLPMLLLARYIKSTGIKMILSGEGADEIF
GGYLYFHKAPNYEQFHEELVKRVQQLHLSDCLRANKVAMAKGVELRVPFLDTEFVNYVMN
IRPQDKIPGPLNEFKDERKSRMEKFVLRAAFAEDYLPDAVLWRQKEQFSDGVGYDWIDSI
RRVATSHVDDAEFAQAAERFPFNTPTTKEAFYYRCIFEQQFPGESAARTVVRWVPRLDWG
CPEDPSGRAQAVHQNKSEQ
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggtatatttgcaatattctccagcgatggcaggcccattgagacgcagtgcttc
cagggcagcaagcacagtttgcgggagctggcgtatcggcagagcggcaggcagcggcat
cgcgggcccgactccacgggcgttgtggttatacccgagcagggcgtggccatggtgcac
gaacgtctgcgcattgtgggcgtcgaaatgggcgatcagccgtttgtctccgacagcggc
gacctcgtgctggtggccaatggcgaaatctacaactatctggagctatccgcgcagatt
gcgaagcggcgcagcggctacaagcccaaaagcgattgccacgtcatattggaactgtat
caggattacggcttggagctgctgcagcacataacgggcatgtacgcctttgcactgtac
gataagcgcagcaaggagctgctgctggcacgcgatcccttcggcattatacccatgtac
ataggcgaggatgccgccggcaacgtgtggatcgcctccgagctgaagtgtctggccgcc
tgctgtgaccgcgtggagacctttacgcccggcgaggcgcgatttgggcgtgtcggcgcc
atgcgtcgctggcgccacttcgagcagccctggcagaagcagctgcccagcctgccctgc
gacctgtcgctgctgcgcgccagcctggagtcggcggtgcgcacccatctccactgcgat
gtgcactttggggcgttgctttcgggcggcgtcgactccagcctgattgcgtcgattgcc
acgaaaatcatgcgcgagaccaatcccagctacagactgaagaccttctccgtgggcctg
cgcaacgcaccggactttgaggccgcccgccaggtggccaagtacatagacagcgagcac
accgagctaatcttcgagatagacgaggccctcgacggcatacgcgacattgtctatcat
ctggagacgtacgatgtgaccacggtgcgctgcagcctgcccatgctgctgctggcgcgc
tacatcaagagcacgggcatcaagatgatactctctggcgagggcgcagacgaaatattt
ggcggctatttgtacttccacaaggcgcccaactacgagcagttccacgaggagctggtg
aagcgtgtgcagcagctgcatttgtccgattgcctgcgcgccaacaaggtggccatggcc
aagggcgtggagctgcgtgtgcccttcctggacacggagtttgtcaactatgtgatgaac
atacggccgcaggacaagatacccggcccgctgaacgagttcaaggatgagcgcaagtcg
cgcatggagaagtttgtgctgcgcgcggcctttgccgaggactatctgccggatgccgtg
ctctggcgccagaaggagcagttctccgatggcgtcggctacgactggattgacagtatt
cgccgcgtggccaccagccacgtggacgatgcggagttcgcgcaggccgccgaacgattt
cccttcaacacgcccaccacgaaggaggcgttttattatcgctgcatatttgagcagcag
tttccgggcgagtcggcggcacggacggtggttagatgggtgccacgcctggactggggt
tgtccggaggatccgtcgggtcgggcgcaggccgtgcaccagaataaatcggagcaataa

DBGET integrated database retrieval system