KEGG   Drosophila virilis: Dvir_GJ13897Help
Entry
Dvir_GJ13897      CDS       T01066                                 

Definition
(RefSeq) GJ13897 gene product from transcript GJ13897-RA (EC:2.7.11.24)
  KO
K04468  
nemo like kinase [EC:2.7.11.24]
Organism
dvi  Drosophila virilis
Pathway
FoxO signaling pathway
Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    Dvir_GJ13897
   04068 FoxO signaling pathway
    Dvir_GJ13897
Enzymes [BR:dvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Dvir_GJ13897
Protein kinases [BR:dvi01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   Dvir_GJ13897
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 434 aa AA seqDB search
MSVSMSLVQGGAAGGAPQGASAILAAAAPYYQPPAVPQDVQPDRPIGYGAFGVVWAVTDP
RDGRRVALKKLPNVFQSLVSSKRVFRELKMLCFFKHENVLSALDILQPPHLDFFQEIYVI
TELLQSDLHKIIVSPQHLSADHIKVFLYQILRGLKYLHSARILHRDIKPGNLLVNSNCVL
KICDFGLARVEEPDQAKHMTQEVVTQYYRAPEILMGARHYSSAVDVWSVGCIFGELLGRR
ILFQAQNPVQQLELITELLGTPTMEDMRHACEGARTHMLRRAPKPPSFSVLYTLSSHATH
EAVHLLCQMLVFDPDKRISVTDALAHPYLDEGRLRYHSCMCKCCFTTSAGMRQYTADFEP
SAGQPFDDLWERKLTSVQQVKEEMHKFIAEQLQTGRVPLCINPQSAAFKSFASSTVAHPS
ELPAFAASMGMTAK
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtttcgatgtcactggtacagggtggtgctgccggtggtgcgccacagggcgcc
agcgcaatattggccgcagcggcaccgtattatcagccgccagcggtgccacaggatgta
cagccggatcgtccaattggctacggtgcattcggcgttgtttgggccgtcacagatccg
cgcgatggacgccgcgtcgcactgaaaaagctgccaaatgtgtttcaatctttggtctca
tccaagcgcgtttttcgtgaactgaaaatgctttgctttttcaagcatgagaacgtgctg
tcagctttggacattttacagccaccacacttggacttctttcaggaaatctatgtgata
actgaactgctgcaatcggatctgcacaagatcatagtgtcgccacagcatctgtctgcc
gatcacatcaaggtgtttctctatcagatattgcgcggcctgaagtatttgcactcggca
cggatactgcatcgcgatataaagccgggcaatttgctggtcaactcgaattgtgtgctc
aagatatgcgactttggactggcacgcgtcgaggagcccgatcaggccaagcacatgacc
caagaggtggtcacacaatattatcgggcgcccgaaatactaatgggtgcgcgccactat
tcatccgcggtggatgtctggtcggtgggctgcatttttggtgagctgctcggccggcgt
atactgttccaggcgcagaatcctgtccagcagctggagctaattaccgagctgctgggc
acacccaccatggaggacatgcgtcacgcctgcgagggcgcacgcacacacatgctgagg
cgtgccccaaagccgccatccttctcagtactctatacgctcagctcgcatgccacgcac
gaggcggtgcatttgctatgccagatgcttgtctttgatccggacaagcgcatttctgtg
acagatgctctggcgcatccgtatctggatgagggtcgtctgcgctatcattcgtgcatg
tgcaaatgctgtttcactacctcagccggaatgcgtcagtatacggcggactttgagcca
tccgccgggcagccctttgatgatttatgggagcgcaagctcacctctgtgcagcaggtg
aaggaggaaatgcataaattcattgccgagcagctgcaaacgggccgtgtaccgctctgc
attaatccgcagagtgcggccttcaagagtttcgccagctcgactgtggcgcatccctcg
gagctgccggccttcgccgcatcaatgggaatgacggcaaaatga

DBGET integrated database retrieval system