KEGG   Drosophila virilis: Dvir_GJ14054Help
Entry
Dvir_GJ14054      CDS       T01066                                 

Definition
GJ14054 gene product from transcript GJ14054-RA
Orthology
K06130  
lysophospholipase II [EC:3.1.1.5]
Organism
dvi  Drosophila virilis
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:dvi00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 216 aa AA seqDB search
MAAPVIVEATAKQTATLIFMHGLGDTGHGWSSALAAVRPPFMKVICPTAPTQPVSLNAGF
RMPSWFDLKTLDIGGPEDEPGIRSARDNIHGMINKELSAGIPANRIVLGGFSQGGALALY
SALTFEQPLAGVVALSCWLPLHKQFPSAKISSDEVPIFQAHGDYDPVVPYKFGQLSASLL
KSFMKNVTFKTYSGLSHSSSDEEMNDVKDIISKWVN
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggcagccccggtcattgttgaggccacggccaagcagacggcgacgctcatattcatg
catggcctgggcgacaccggacatggctggagcagcgccttggccgctgtgcgtccgcca
ttcatgaaggtgatctgtccaacggcgccgacacagcccgtttcgctgaatgccggattt
cgtatgccctcgtggttcgatctgaagacactggacattggcgggcccgaggatgagcca
ggtatacgctctgcacgagacaatatacacggcatgataaacaaggagctgagcgccggc
ataccggccaatcgcattgtccttggcggcttctcacagggcggcgcactggctctctac
tcggcattgacctttgaacagccactggccggcgttgttgcgctatcgtgctggctgcca
ctgcacaagcagttccccagtgccaagattagcagcgatgaggtgcctatattccaagca
cacggcgactatgatcctgtggtgccttacaaatttggacagctcagcgccagtctgctc
aagtcgttcatgaagaatgtcaccttcaagacatatagcggactctcgcactcgtcctcc
gacgaagaaatgaatgatgtcaaggacataatcagtaaatgggtaaactaa

DBGET integrated database retrieval system