KEGG   Drosophila virilis: Dvir_GJ14135Help
Entry
Dvir_GJ14135      CDS       T01066                                 

Definition
GJ14135 gene product from transcript GJ14135-RA
Orthology
K00731  
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
dvi  Drosophila virilis
Pathway
Mucin type O-Glycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    Dvir_GJ14135
Enzymes [BR:dvi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.122  glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase
     Dvir_GJ14135
Glycosyltransferases [BR:dvi01003]
 Glycan extension
  Type 3 chain
   Dvir_GJ14135
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 386 aa AA seqDB search
MTANSLLGRSLLNEGRSNKRSFVSLIVGLVVGFCLAELFVYSSTPERGEYVPYDGHRHGD
VNDAHHSHDMLELAGPEQDVGTHEHAHENTSIAEKLYSEVRILCWIMTNPANHQKKARHV
KRTWGKRCNKLIFMSSAKDEELDSVALPIGEGRNNLWGKTKEAYKYIYKNHINDADWFLK
ADDDTYTIVENMRYMLYPYNPETPVYFGCKFKPYVKQGYMSGGAGYVLSREAVRRFVVEA
LPNPKLCKNDNTGAEDVEMGKCMENVKVLAGDSRDANGRGRFFPFVPEHHLIPSHTDKKF
WYWQYIFYKTDEGLDCCSDNAISFHYVSPNQMYVLDYLIYHLRPYGIVNTPDALPNKLGL
GELMPAPKEPKELEESNTAETQKQTQ
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgactgccaatagcctactcggacgatccttacttaatgaaggacgttccaacaaacgt
tccttcgtctcactgatcgtcggcctggtcgttggcttctgtctggccgagctatttgtg
tactcatcgacgccggaacgtggcgagtatgtgccgtacgatggccaccggcatggcgat
gtcaacgatgcgcatcacagtcacgacatgctggagctggctggtccagagcaggatgtg
ggcacgcacgagcatgcgcacgagaataccagcattgcggagaagctgtacagcgaggtg
cgaattctgtgctggatcatgacaaatcccgccaaccatcagaagaaggcgcgccacgta
aagcgcacgtggggcaagcgttgcaataagctgatcttcatgagctccgccaaggatgag
gaactggattctgtggcattgcccattggcgagggacgcaataatctgtggggcaaaaca
aaggaggcgtacaagtacatctacaagaaccacatcaacgatgcggactggttcctaaaa
gcagacgacgatacctatacgattgttgagaacatgcgctatatgctatatccctataat
cccgagacgcccgtctactttggctgcaagttcaagccgtacgttaaacaaggctatatg
tccggtggcgctggctatgtgctcagtcgggaggcagtgcggcgctttgtcgtcgaagcg
ttgcccaatcccaagttatgcaagaatgacaataccggcgccgaggatgtggaaatgggc
aagtgcatggagaatgttaaggtcttggcgggcgattcccgtgatgccaacggacgtggt
cgcttctttccctttgtgccggagcatcatttgataccctcgcacacggacaagaagttc
tggtactggcagtatatcttctataaaacagacgagggtctggactgctgttcggataat
gccatatcatttcattatgtgtcgcccaatcaaatgtatgtgctagattatttgatatac
catctgaggccatatggcatagttaatacgccagatgctctgcccaataagctggggctg
ggcgaattgatgccggcgcctaaagagcccaaggagctggaggaatcaaatactgccgaa
acacaaaagcagacgcagtga

DBGET integrated database retrieval system