KEGG   Drosophila virilis: Dvir_GJ14204Help
Entry
Dvir_GJ14204      CDS       T01066                                 

Definition
(RefSeq) uncharacterized protein
  KO
K14156  choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
dvi  Drosophila virilis
Pathway
dvi00564  Glycerophospholipid metabolism
dvi01100  Metabolic pathways
Module
dvi_M00092  Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Dvir_GJ14204
Enzymes [BR:dvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     Dvir_GJ14204
    2.7.1.82  ethanolamine kinase
     Dvir_GJ14204
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Choline_kinase APH
Motif
Other DBs
NCBI-GeneID: 6628213
NCBI-ProteinID: XP_002051059
FlyBase: FBgn0201419
UniProt: B4LUP6
Position
Unknown
AA seq 591 aa AA seqDB search
MRQRKHLNKHKTRRQKQQKLPEIDENCCKRPRCNYEHIWQHFRRNATLEEIRQAASRICR
DYLTGRWKVVTPEQLVVKRISGGLSNFLYYVSLPDLDDFDEQQLLEVEQQQGNANVSIGK
HVIAASVFAKNSNNNNNNNNNSNNNNNNNNNSYTAAAVAPEAAENLALTVVVGVDETSSP
TPVPVSVADDDDDAALSAKQANKRRRFDSDSGDSSLLRRLHTPKQEPREVLLRIYGQTHG
DHALESMITESVVFALLSERNFGPKLHGIFPGGRIEQYIPARPLATTELGDARISMKIAE
KMGEIHSLNIPMSKEPDWIWNCMDRWLASLESIVKGKIESKPNSTVLQKQRNLMRSINYV
QEIAWLRSVIDAGAYPVVFCHNDLQEGNILLRQSSSGQERTPRESISILRSNFDETLGDS
LDGNSNLDTDDNKSPSASPCAELDTTDDSALDSSFMSDHEPDLIIIDFEYCAYNYRGFDL
ANHFIEWTFDYTNPQFPYFHHYKEQYATAQQRRDFIVNYLKKYHDDEHYEPNVEELDTVD
AEIRLFTMLSHLFWSLWSVVNVTSAIEFGYWEYGISRILEYQKLKSAYLAK
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atgagacaacgtaaacatttaaataaacacaaaactcgtcgtcaaaagcagcaaaaatta
ccagaaattgatgagaattgttgtaaacgccctcgttgtaattatgaacatatctggcaa
cattttcgacgcaatgccacactcgaggaaattcgccaagcggcttctcgcatttgccgc
gactatctaaccggacgctggaaggtggttaccccagaacagcttgtggtgaagcgcatc
agtggcggcctctcgaatttcttgtattacgtaagtctgcccgacttggatgacttcgat
gagcagcaattgttggaggtggaacagcagcaaggaaatgccaacgtcagcattggcaag
cacgtcatagccgcttcggtatttgccaagaatagcaacaacaacaacaacaacaacaac
aacagcaacaataacaataacaataacaataacagctacacggcagctgctgtcgccccg
gaggcggccgaaaatttggcactaactgtggttgtgggcgttgatgaaaccagcagcccc
acccctgtacccgtgtctgtcgccgacgatgatgacgacgcagcgctaagcgccaagcag
gcaaacaaacggcgacgcttcgatagcgacagcggcgactcgagtttgctgaggcggctg
cacacccccaagcaggaaccacgtgaggttctactgcgcatctatggacaaacccatggc
gatcatgcattggagagcatgatcaccgagtccgtggtgtttgccttgctaagtgagcgc
aattttggacccaagctgcatggcatctttcccggtggacgcatcgagcagtatataccg
gcacgtccgttggcaaccacagagctgggcgatgcgcgcatttcgatgaagatcgctgag
aaaatgggcgaaatacacagcctgaatataccaatgtccaaggaaccggattggatctgg
aactgtatggatcgttggctggccagtttggagagcattgtgaagggcaagattgaatcg
aagcccaattcgacagtgctgcaaaagcaacggaatttgatgcgctccattaactacgtg
caggagatagcctggctgagatcggtgatagatgccggcgcctatcccgttgtcttttgc
cacaacgatctgcaggagggcaacatattgttaaggcaatcgagcagtgggcaagagcgt
acaccaagggaatccataagcatcttgcgatccaactttgatgagaccctgggcgacagc
ctggatggcaacagcaatttggatacggatgacaacaaatcgccaagcgcctcaccatgc
gccgaattggacaccacagatgattctgcactggactccagttttatgtccgatcatgag
ccggatctcattatcattgattttgaatattgcgcctacaactatcggggcttcgatttg
gccaatcacttcatcgaatggacattcgactataccaatccgcagttcccctactttcac
cattataaagagcaatatgcaacggctcagcagcgacgcgactttattgtcaactatcta
aagaaatatcatgatgatgagcattacgaacccaatgtcgaagagctcgatacggtcgat
gccgagatacggctattcacaatgctctcacatctcttctggagcctctggtccgtggtt
aatgttacttccgccattgagtttggttattgggaatatggcatttcacgcatactggag
tatcaaaagctaaagtcggcctatttggcaaaatga

DBGET integrated database retrieval system