KEGG   Drosophila virilis: Dvir_GJ14204Help
Entry
Dvir_GJ14204      CDS       T01066                                 

Definition
GJ14204 gene product from transcript GJ14204-RA
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
dvi  Drosophila virilis
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Dvir_GJ14204
Enzymes [BR:dvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     Dvir_GJ14204
    2.7.1.82  ethanolamine kinase
     Dvir_GJ14204
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 545 aa AA seqDB search
MRQRKHLNKHKTRRQKQQKLPEIDENCCKRPRCNYEHIWQHFRRNATLEEIRQAASRICR
DYLTGRWKVVTPEQLVVKRISGGLSNFLYYVSLPDLDDFDEQQLLEVEQQQGNANAAENL
ALTVVVGVDETSSPTPVPVSVADDDDDAALSAKQANKRRRFDSDSGDSSLLRRLHTPKQE
PREVLLRIYGQTHGDHALESMITESVVFALLSERNFGPKLHGIFPGGRIEQYIPARPLAT
TELGDARISMKIAEKMGEIHSLNIPMSKEPDWIWNCMDRWLASLESIVKGKIESKPNSTV
LQKQRNLMRSINYVQEIAWLRSVIDAGAYPVVFCHNDLQEGNILLRQSSSGQERTPRESI
SILRSNFDETLGDSLDGNSNLDTDDNKSPSASPCAELDTTDDSALDSSFMSDHEPDLIII
DFEYCAYNYRGFDLANHFIEWTFDYTNPQFPYFHHYKEQYATAQQRRDFIVNYLKKYHDD
EHYEPNVEELDTVDAEIRLFTMLSHLFWSLWSVVNVTSAIEFGYWEYGISRILEYQKLKS
AYLAK
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgagacaacgtaaacatttaaataaacacaaaactcgtcgtcaaaagcagcaaaaatta
ccagaaattgatgagaattgttgtaaacgccctcgttgtaattatgaacatatctggcaa
cattttcgacgcaatgccacactcgaggaaattcgccaagcggcttctcgcatttgccgc
gactatctaaccggacgctggaaggtggttaccccagaacagcttgtggtgaagcgcatc
agtggcggcctctcgaatttcttgtattacgtaagtctgcccgacttggatgacttcgat
gagcagcaattgttggaggtggaacagcagcaaggaaatgccaacgcggccgaaaatttg
gcactaactgtggttgtgggcgttgatgaaaccagcagccccacccctgtacccgtgtct
gtcgccgacgatgatgacgacgcagcgctaagcgccaagcaggcaaacaaacggcgacgc
ttcgatagcgacagcggcgactcgagtttgctgaggcggctgcacacccccaagcaggaa
ccacgtgaggttctactgcgcatctatggacaaacccatggcgatcatgcattggagagc
atgatcaccgagtccgtggtgtttgccttgctaagtgagcgcaattttggacccaagctg
catggcatctttcccggtggacgcatcgagcagtatataccggcacgtccgttggcaacc
acagagctgggcgatgcgcgcatttcgatgaagatcgctgagaaaatgggcgaaatacac
agcctgaatataccaatgtccaaggaaccggattggatctggaactgtatggatcgttgg
ctggccagtttggagagcattgtgaagggcaagattgaatcgaagcccaattcgacagtg
ctgcaaaagcaacggaatttgatgcgctccattaactacgtgcaggagatagcctggctg
agatcggtgatagatgccggcgcctatcccgttgtcttttgccacaacgatctgcaggag
ggcaacatattgttaaggcaatcgagcagtgggcaagagcgtacaccaagggaatccata
agcatcttgcgatccaactttgatgagaccctgggcgacagcctggatggcaacagcaat
ttggatacggatgacaacaaatcgccaagcgcctcaccatgcgccgaattggacaccaca
gatgattctgcactggactccagttttatgtccgatcatgagccggatctcattatcatt
gattttgaatattgcgcctacaactatcggggcttcgatttggccaatcacttcatcgaa
tggacattcgactataccaatccgcagttcccctactttcaccattataaagagcaatat
gcaacggctcagcagcgacgcgactttattgtcaactatctaaagaaatatcatgatgat
gagcattacgaacccaatgtcgaagagctcgatacggtcgatgccgagatacggctattc
acaatgctctcacatctcttctggagcctctggtccgtggttaatgttacttccgccatt
gagtttggttattgggaatatggcatttcacgcatactggagtatcaaaagctaaagtcg
gcctatttggcaaaatga

DBGET integrated database retrieval system