KEGG   Drosophila virilis: Dvir_GJ14298Help
Entry
Dvir_GJ14298      CDS       T01066                                 

Definition
GJ14298 gene product from transcript GJ14298-RA
Orthology
K15719  
protein O-GlcNAcase / histone acetyltransferase [EC:3.2.1.169 2.3.1.48]
Organism
dvi  Drosophila virilis
Brite
Enzymes [BR:dvi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dvir_GJ14298
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.169  protein O-GlcNAcase
     Dvir_GJ14298
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1024 aa AA seqDB search
MEDGHMREKCETLEHTAQDRQRQFICGVIEGFYGRPWTTEQRKDLFRKLKKLGMDSYMYA
PKDDYKHRAYWRELYTVEEADHLSSLITAAKEAGIVFYYALSPGLDMTYSSPKEIGTLKR
KLDQVSQFGCEAYALLFDDIESELSKADKEVFQTFANAQVSVTNEIFTHLGSPKFLFCPT
QYCASRAVPSVADSEYLNTLGSKLNNDIDILWTGDKVISKIVTIESIREITEILRRPPVI
WDNLHANDYDQKRVFLGPYSGRSPELIPYLRGVMTNPNCEFYGNFIAVHTLAFWSRCSLD
AKMNSSLSADIKLETENEDDLPVECLSKNVYHPRLALKNAISEWLPEFFVAKEAFGPITK
PQPQVEMVMPIIPIIPSINTCMTLTTTTTTSTNTRTVPEVNTTQLQALADVCSTVSSSLT
PISNPVMNSLVSPTKVVTNDEIINPIPTTVASNIELPKKIPISIVPAPIMEAKSVEETIK
LSCEAFEPAAKLEPAPADVNKVDISPTSANDILIAEKRDQVANLNVDTMLDENSLSPLSA
CANEPMECSSSINSQISPKEAIKLAGDDVVMEESVNDVNSMHVESVSASPESNAEMHEAD
EEELEDLADKSISSENKINLDDLSLLCDLFYLPFEHGSRGLKLLSEFQWLKVNANVLLHD
RAGGGGHPDAKAIKPEISEWLQRSEFFSKLCGGVLDLLIKIANCENKEICHDLYSYVWDI
SGALSLLNCYVKWLALGQFPPNMSSYTEGSYTWFSKGWKEAFMSGDQEPWVFRGGLTADL
QRLMPVDSGNDLFVYKLPEQPTANYYLLRPYQNSDEPQVNKICTRTYLQWQSEPDGDEIL
LPAPLGDIVADALVGAHLTIHPELCLVAYDQSDAIVGYVCAAPDINIFHRNTEVCWLTEL
REKYPKTLLETLADGNNSKSHKLSVRFIEDFHRDEELVCPNEVCGTFPAVISAAILREAE
QHDNGIAKRLLTVLLAALRANGCFGVHVCVPEQDKEQMNFYTKIGFVEVYRDGRSKCIYL
GRRF
NT seq 3075 nt NT seq  +upstreamnt  +downstreamnt
atggaagacggccacatgagggaaaaatgtgaaactttagagcataccgcacaggatcgt
caacgccaattcatttgcggcgtaattgagggcttctacggccgaccatggacaaccgaa
cagcgaaaagatttgtttcgcaaattaaaaaaactgggcatggactcgtatatgtacgca
cccaaagatgactacaagcaccgcgcctactggcgtgagctctacacggtcgaggaggcg
gatcacttatcaagtctgattactgccgccaaagaagcgggcattgttttctactatgcc
ctgtcgccgggcctggatatgacttatagcagcccgaaggagattggcacgctcaagcgt
aagctagatcaggtatcgcagtttggctgcgaggcatatgccctgctcttcgatgacatt
gaatcggagctgtccaaggccgacaaagaggtgttccagacgttcgccaatgcccaggtc
tcggtgaccaatgagattttcacccacttgggcagtccaaagtttctcttctgccccacg
cagtactgtgcctcgcgtgccgtgcccagcgttgcggattcggaatatctgaacacgctg
ggctccaagctgaacaacgacatcgacatactctggacgggtgacaaggtgatatcaaag
attgtgacgattgaatcgatacgggaaataaccgagatactgcgtcgtccgcctgtcatt
tgggataatctccatgcgaacgattacgatcagaaacgtgtcttccttggcccgtactcg
ggtcgttcgccggagctgataccctatctgcgtggtgttatgaccaatccgaattgcgag
ttctatggcaatttcatagcagtgcatacgctggctttctggtcgcgctgcagtctggac
gcaaagatgaacagctccctgagcgctgatatcaagctggagactgaaaacgaggacgat
ttgcccgtggagtgtctgtccaagaacgtctatcatccgcgcttggcgctcaaaaatgcc
atcagcgagtggctgccggagttttttgtggcgaaggaagcctttggacctattaccaag
ccgcagccgcaagtggaaatggtcatgcccataattcctataataccgtcgattaacaca
tgcatgaccctgacgacgacgacgaccacgtcgacaaatacgcgcacagtgcccgaggtg
aacaccacccagctccaggcgctggccgatgtatgcagcaccgttagctcctcgctgacg
cccatttctaatccggtgatgaactctttggtgtccccgacaaaagttgtgaccaatgac
gagatcattaatcccatacccacaacagttgcatccaacattgagttgccaaaaaagata
cctatctcgattgtgccggcgcccataatggaggccaagagtgttgaggagaccatcaaa
ttgagctgtgaagcattcgagccggcagctaagctggagccagcgccagcggacgtcaac
aaagtcgacatctcgccgacttctgccaatgatattctcatagctgagaaacgcgaccag
gtggccaatttgaatgtggataccatgctggatgaaaacagtctgagtcccttaagcgct
tgcgccaacgagcccatggagtgcagcagcagcattaactcacagatttcgccaaaggaa
gccatcaagttggctggcgatgatgtcgtcatggaggaatcggtcaacgatgttaatagc
atgcacgtggaaagcgtctcagcgtcgccagagtctaatgcggagatgcacgaggcggac
gaggaggagctggaagatttggcggacaaatcaatttctagcgagaacaagattaattta
gatgatttaagcctgctctgtgatctattctatttaccctttgagcacggcagtcgtggc
ctgaagctgctcagcgagttccaatggctgaaagtcaatgcgaatgtgctgctccacgat
cgcgccggtggcggcggccatcccgatgctaaggctatcaagcccgagattagcgaatgg
ctgcaacgctccgaattcttctccaagctgtgcggcggcgttctcgacctgttgatcaaa
attgcaaattgtgagaacaaggaaatatgccatgatttgtattcgtatgtgtgggatata
tccggtgcactgtcgctgctcaattgctatgtcaagtggctggccttgggtcagttcccg
ccgaacatgtcctcatacacggagggcagctacacgtggtttagcaaaggctggaaagag
gcgttcatgtctggcgatcaggagccttgggtgtttcgcggcggcctcacggccgacttg
cagcgcctgatgcccgtcgattcgggcaacgatttgtttgtttacaagttgcccgagcag
ccgacagccaattactatctattgagaccatatcagaattccgatgagccgcaggtcaac
aagatctgtacgcgcacatatttgcagtggcagagcgagccggacggcgatgagatcttg
ttgcccgctccattgggcgatattgttgccgatgccttggtcggcgcgcatttaacaatt
catccggagctgtgcctagtggcctacgatcagagcgacgcgattgttggatatgtctgc
gctgctccggacataaatatctttcatcgcaacacagaggtttgctggctaacggagctg
cgcgaaaagtatccaaaaacgttgctagaaactttagccgacggcaacaacagcaaatcc
cacaagctgagcgtgcgtttcatagaggattttcatagagacgaggagctggtgtgcccc
aacgaggtgtgcggcacctttccggcggtgataagcgccgccattctaagggaggcggaa
cagcacgacaacggcattgccaagcgactattgaccgtcctgctggccgcgctgcgcgcc
aacggctgctttggtgtgcacgtctgtgtgcccgagcaggataaggagcagatgaacttc
tacacgaagattggctttgttgaggtctatcgcgatgggcgcagcaagtgcatttatttg
gggcggcgcttttag

DBGET integrated database retrieval system