KEGG   Drosophila virilis: Dvir_GJ14347Help
Entry
Dvir_GJ14347      CDS       T01066                                 

Definition
(RefSeq) GJ14347 gene product from transcript GJ14347-RB
  KO
K11842  
ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.4.19.12]
Organism
dvi  Drosophila virilis
Brite
Enzymes [BR:dvi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dvir_GJ14347
Peptidases [BR:dvi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dvir_GJ14347
Ubiquitin system [BR:dvi04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    Dvir_GJ14347
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 424 aa AA seqDB search
MGANVSQLEREIGSDLFPPNEHYFGLVNFGNTCYSNSVLQALYFCKPFREKVLEYKAKNK
RPKETLLSCLADLFYSIATQKKKVGSIAPKKFITRLRKEKEEFDNYMQQDAHEFLNFLIN
HINEIILAERNTGSSTGKTAAGGAIPGPNGGQMPGNSSTTTKLSSNSNSSNSTTTSTSNS
TATNGNCSNSTGSLSVLDGNGSLTATTTPIAQTNGANTEPTWVHEIFQGILTSETRCLNC
ETVSSKDENFFDLQVDVDQNTSITHCLRCFSNTETLCSDNKFKCDNCCSYQEAQKRMRVK
KLPMILALHLKRFKYMEQFNRHIKVSHRVVFPLELRLFNTSDDAVNPDRLYDLTAVVIHC
GSGPNRGHYISIVKSHGLWLLFDDDMVDKIEASTIEDFYGLTSDIHKSSETGYILFYQSR
DCAA
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgggcgccaacgtgtcgcagctggagcgcgagatcggctctgatctgtttccgccgaac
gagcactacttcgggctggttaattttgggaacacttgctatagcaactcggtgctgcag
gcgctgtatttctgcaagccctttcgcgagaaggtgctcgaatataaggccaagaataag
cggcccaaggagacgctgctctcgtgcctggccgatctcttctacagcattgccacgcag
aaaaagaaggtcggctcgatagcgcccaagaagtttataacacgattgcgcaaggagaag
gaggagttcgacaactatatgcagcaggatgcgcatgagtttctcaactttttgattaat
cacataaacgagattattttggccgaacgcaacacgggaagcagcaccgggaagacggct
gctggtggcgccattcccggcccaaatggtggccaaatgccaggaaacagcagcaccaca
acaaagctaagctcgaactcgaattcgtcaaattccacaacgacctcgacctccaactcg
acggcaaccaacggcaattgcagcaactcgaccggctcgttgagtgtgcttgatggaaat
gggagtctaaccgccacgaccacgcccatagcacaaacaaacggggccaacacggagcca
acatgggtgcacgagatcttccagggaatacttacgtcagagacacgctgcctcaactgt
gagacggtgagcagcaaggacgagaatttcttcgatctgcaggtggacgttgatcagaat
acgtccataacgcattgcttgcgctgcttcagcaacacggagaccctctgctcggataac
aagttcaagtgcgacaattgctgcagctaccaggaggcacagaagcggatgcgcgtcaag
aagctgccgatgatcctggcgctgcacttgaagcgtttcaagtacatggagcagttcaat
cggcacattaaggtgtcgcatcgcgtcgtctttccgctggagctgcgcctgttcaacacc
tcggacgatgcggtcaatccggacaggctttacgatctgaccgcggtggtaattcactgc
ggatcgggaccgaatcgcggccattacataagcattgtgaagagtcacgggctctggctg
ctcttcgacgacgacatggtcgacaagattgaggcctcgaccatcgaggacttttatggc
ctcacctcggatatacacaagtcctcggaaaccggctacattctgttctatcaatcgcgc
gactgcgctgcgtaa

DBGET integrated database retrieval system