KEGG   Drosophila virilis: Dvir_GJ14347Help
Entry
Dvir_GJ14347      CDS       T01066                                 

Definition
GJ14347 gene product from transcript GJ14347-RA
Orthology
K11842  
ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.1.2.15]
Organism
dvi  Drosophila virilis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 363 aa AA seqDB search
MGANVSQLEREIGSDLFPPNEHYFGLVNFGNTCYSNSVLQALYFCKPFREKVLEYKAKNK
RPKETLLSCLADLFYSIATQKKKVGSIAPKKFITRLRKEKEEFDNYMQQDAHEFLNFLIN
HINEIILAERNTGSSTGKTAAGGAIPGPNAQTNGANTEPTWVHEIFQGILTSETRCLNCE
TVSSKDENFFDLQVDVDQNTSITHCLRCFSNTETLCSDNKFKCDNCCSYQEAQKRMRVKK
LPMILALHLKRFKYMEQFNRHIKVSHRVVFPLELRLFNTSDDAVNPDRLYDLTAVVIHCG
SGPNRGHYISIVKSHGLWLLFDDDMVDKIEASTIEDFYGLTSDIHKSSETGYILFYQSRD
CAA
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgggcgccaacgtgtcgcagctggagcgcgagatcggctctgatctgtttccgccgaac
gagcactacttcgggctggttaattttgggaacacttgctatagcaactcggtgctgcag
gcgctgtatttctgcaagccctttcgcgagaaggtgctcgaatataaggccaagaataag
cggcccaaggagacgctgctctcgtgcctggccgatctcttctacagcattgccacgcag
aaaaagaaggtcggctcgatagcgcccaagaagtttataacacgattgcgcaaggagaag
gaggagttcgacaactatatgcagcaggatgcgcatgagtttctcaactttttgattaat
cacataaacgagattattttggccgaacgcaacacgggaagcagcaccgggaagacggct
gctggtggcgccattcccggcccaaatgcacaaacaaacggggccaacacggagccaaca
tgggtgcacgagatcttccagggaatacttacgtcagagacacgctgcctcaactgtgag
acggtgagcagcaaggacgagaatttcttcgatctgcaggtggacgttgatcagaatacg
tccataacgcattgcttgcgctgcttcagcaacacggagaccctctgctcggataacaag
ttcaagtgcgacaattgctgcagctaccaggaggcacagaagcggatgcgcgtcaagaag
ctgccgatgatcctggcgctgcacttgaagcgtttcaagtacatggagcagttcaatcgg
cacattaaggtgtcgcatcgcgtcgtctttccgctggagctgcgcctgttcaacacctcg
gacgatgcggtcaatccggacaggctttacgatctgaccgcggtggtaattcactgcgga
tcgggaccgaatcgcggccattacataagcattgtgaagagtcacgggctctggctgctc
ttcgacgacgacatggtcgacaagattgaggcctcgaccatcgaggacttttatggcctc
acctcggatatacacaagtcctcggaaaccggctacattctgttctatcaatcgcgcgac
tgcgctgcgtaa

DBGET integrated database retrieval system