KEGG   Drosophila virilis: Dvir_GJ14419Help
Entry
Dvir_GJ14419      CDS       T01066                                 

Definition
(RefSeq) uncharacterized protein
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
dvi  Drosophila virilis
Pathway
dvi00040  Pentose and glucuronate interconversions
dvi00053  Ascorbate and aldarate metabolism
dvi00830  Retinol metabolism
dvi00860  Porphyrin and chlorophyll metabolism
dvi00980  Metabolism of xenobiotics by cytochrome P450
dvi00982  Drug metabolism - cytochrome P450
dvi00983  Drug metabolism - other enzymes
dvi01100  Metabolic pathways
Module
dvi_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dvir_GJ14419
   00053 Ascorbate and aldarate metabolism
    Dvir_GJ14419
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    Dvir_GJ14419
   00860 Porphyrin and chlorophyll metabolism
    Dvir_GJ14419
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dvir_GJ14419
   00982 Drug metabolism - cytochrome P450
    Dvir_GJ14419
   00983 Drug metabolism - other enzymes
    Dvir_GJ14419
Enzymes [BR:dvi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     Dvir_GJ14419
Glycosyltransferases [BR:dvi01003]
 Others
  Hydrophobic molecule
   Dvir_GJ14419
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_transf_4
Motif
Other DBs
NCBI-GeneID: 6634932
NCBI-ProteinID: XP_002058443
FlyBase: FBgn0201631
UniProt: B4MBE0
Position
Unknown
AA seq 532 aa AA seqDB search
MNLRWALHFMLLSLLALQEIHFTAGSRILAAFFLPGKSHFMMTNSIIRELVKRGHEVTFI
TPFSLAKENLGANYKEIVLPQYDMWTDIKQMSNREIILDMADVSSLKFLRMLQVMGVHST
DFAFEQPEIQALINAEHKVGQYDLLLAEQFYNEGALILGHLYQIPVITVSTFGNTNYFSE
LVGIITPWSYSPHGFMTFTNRMSLSERLLNVFICGTEHLMRRFLYYPAHDEVLRKHFAKL
LDVVPTTKQLERNISAILMNNYMPLEAPRPISFNQISVGGLHILPPKPLPQHLQKFLDEA
THGAIYFSLGTQVRSADLPPEKLKIFLDAFGSLKQRVLWKFEDDSFPNLPANVMIQKWMP
QGDILAHPNVKVFIAHGGLFGLQEALHYGVPVLGMPVYCDQHFNIHQGKADGYALGLDYR
TISTEQLRSSLLELLENPKYRETMKRASRIFRDRPLGAMDTAMFWIDYVIEHQGAPHMVS
AGLDLTWYQFYLLDVIAIFVATVVAIIVLPIWILCRILRKSQKQPKRKAKIN
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaagatgggcgcttcattttatgctgctgagtctattggcccttcaggaaata
cactttacggctggttcacgaattctggctgcgtttttccttcccggcaaaagtcatttt
atgatgacaaactcgatcatcagggaactggtcaagcgcggacatgaggtgacttttatc
acgcctttttcactggccaaagagaacctgggagctaattataaggaaattgtgctgcca
caatacgatatgtggacagatataaagcaaatgtcgaacagagaaataattttggatatg
gcggatgtgtctagcctgaaattcctgcgtatgctgcaggtgatgggcgtgcatagcacg
gactttgcctttgagcagcccgagattcaggctctgatcaatgccgagcataaggtgggc
cagtacgatctgcttttggccgagcagttctacaatgagggcgccttgatactgggtcat
ctgtatcagatacccgtcatcacggtctccacgttcggcaacacgaactacttcagcgag
ctggtgggcatcattacgccctggtcgtatagtccgcatggcttcatgaccttcaccaat
cgcatgagcttgtcggagcggctgctcaacgtgttcatctgcggcacggagcatctgatg
cgccgtttcctctattatcccgcccatgatgaggtgctcagaaagcactttgccaagctg
ctcgatgtggtgcccacaacgaagcagctggagcgcaacatctccgccatcctcatgaac
aactatatgcccctggaggcacccagacccatttccttcaaccaaatatccgtcggcgga
ctgcacattctgccgcccaagcctctgccgcaacatttgcaaaagttcctcgacgaggca
acacatggcgccatttactttagtttgggtacacaggtgcgcagcgcggatctgccgccc
gagaagttgaagatcttcttggacgcctttggcagtctgaagcagcgcgtgctgtggaaa
ttcgaggacgacagctttcccaatctgcccgccaatgtcatgatacagaagtggatgcca
cagggtgacatattggcacatcccaacgtgaaggtcttcattgcccatggcggactcttc
gggctgcaggaggcgctgcattatggcgtgcccgtgctgggcatgcccgtctattgtgac
cagcactttaacatccaccagggcaaggccgatggctatgctcttggcctggattatcgc
acgatttccactgagcagctgcgctcctcgctgctggaactgctcgagaatcccaagtat
cgggagaccatgaaacgtgcgtctcgcatcttccgggatcggccgctcggcgccatggac
acggccatgttctggatcgactacgtcatcgagcatcaaggtgcaccgcacatggtttca
gctggcctggatctgacctggtatcagttctacctgctcgatgtgattgccatatttgtg
gccacagttgtggccataattgtgctgcccatttggattttatgccgcatcttacgcaaa
tctcaaaagcagcccaagaggaaggcgaaaattaattaa

DBGET integrated database retrieval system