KEGG   Drosophila virilis: Dvir_GJ14517Help
Entry
Dvir_GJ14517      CDS       T01066                                 

Definition
GJ14517 gene product from transcript GJ14517-RA
Orthology
K11832  
ubiquitin carboxyl-terminal hydrolase 1 [EC:3.1.2.15]
Organism
dvi  Drosophila virilis
Pathway
Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Genetic Information Processing
  Replication and repair
   03460 Fanconi anemia pathway
    Dvir_GJ14517
Enzymes [BR:dvi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Dvir_GJ14517
Peptidases [BR:dvi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dvir_GJ14517
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1105 aa AA seqDB search
MHEYDIYELKEEQARLPPTTSPNNRSPNNKQHKNISPKSETIQTTKASTKSTATDTDEPS
SPTSTYSAIYPAVQEYVDQVVQPPTPAPKGVEVVPKRKRQRRVYVAEFSRCASLRSRQAA
PVEVLVPETSETTAPPPPPPSAQTSPTPTEATEYHKYIKLEHFKPEFWNRIEEEPEPKLT
GKKRRGGVGGRNRKRRNRIELDLNFSAETAAAIAAAQIELDSGKPVSRAFHKRKRSCNMS
LYDRRYQTSNDEQRRVANGYAPVGSGLRAGNAAGAPEVDTPELQSHQYYVPATGSNLSGA
PTGPGLNGSGVTALNHVPAMGTLCNIGNTCYLNSVVYTLRFAPHFLHNLHHLIHDLHVVQ
QTIVRRHNAKSASLGRNVSGGGQLEHARSWSSKDLANADPYISSTSNGSGSGSGSGTNST
SSGSRKSSHQSVSEKLHELYNNLHGNEMIDSSEPYHADTLLHAIQDVNATFEGNQQQDAH
EFLMCVLNCIRETNQSLIKAIGECPEVIANGYIANPDDTDTVDALDRTDAGNHALMGASG
NGSIATSQTQSTTTTKTSFFSRKSKRKDEVKSSKATRLQSPLKDNSPTTAGGGGMASTHA
AASNSLFYLNTVDLSGASAAATASAASNAPAKYSSDDEINTASLLKDKMRLEERIRELNL
NFFSSDFEGIVVLTTKCLSCETITRQKQGMLDISVPVPISGYDNAELQEKPSAYIQNSCI
TREYFRGDNKYSCNQCTGYTEAIRSISYEVLPRLLVIQLNRFSGGMEKVSTYVPTTFTLP
CFCAKCCELSDANKLHVYKLYSVITHVGATLTVGHYIAYTCFLDLASDYVNCPKDRRNAT
SSAQQQQSAATAAAGNENAAPSNNGSSSIASTPVVSAAASALASSGTSLIKKMKFGRSKA
SSSGDMSKNVKQLNGLTSKTITNGIGKLSMNTTCHGVNCCAMRLCCSQQASTAGSNSASS
SDFSEESLQNGSNSNLSYGSVPNNCAPYPTGYGSTGRGGVKANYAQSSSEPIWYMCDDDK
IKAMTQREFEELLSPTRKITITPYLLFYARFDLQQPTQTTPPKSCASSTPTPPPAMSSAA
AAAASAQPPQSTWSNDSLQGGLHKI
NT seq 3318 nt NT seq  +upstreamnt  +downstreamnt
atgcacgaatatgacatatatgagctgaaagaggaacaagcacgtcttccgccaaccacc
agccccaataacagaagtccaaacaacaagcaacataagaatatttcgccaaagtcagaa
actatacagacaacgaaagcttccacaaaatccacagccacagacaccgacgaaccgtcg
tcgccaacttcaacatactcggccatttatccagcagttcaggagtacgtggatcaagtt
gtacagccgccaacgccagcgcccaaaggcgttgaggtggtgccgaagcgcaaacgtcag
cgtcgcgtttatgtggcagagttttcgcgctgtgccagtctaagatcccgtcaagcagcg
ccagttgaggtactcgtgccggagacatcggagacaacagctccgccaccgccaccgcca
tcggcacagacatcacccacgcccacagaggcgacagagtatcataagtatataaaacta
gaacattttaagccagagttttggaatcgcattgaggaggagccggagccaaagttaact
ggcaaaaagagacgcggcggcgtcggcggtcgtaaccgaaagcgtcgcaacaggattgag
ctagatttgaatttctcagcggagacagcggcggccattgcggcagctcaaattgagctt
gattcgggcaaaccggtgtcacgcgcctttcataaacgcaaacgcagctgcaacatgtcc
ctatacgatcgacgctatcagacgtccaatgacgagcagcggcgcgtggccaatggttat
gcaccagtcggtagtggcctgcgtgccggcaatgcagccggtgcacccgaagtcgataca
ccagaactgcagagccatcagtattatgtgcccgccactggcagcaatttaagcggcgca
cccactggccccggactcaatggcagtggggttacggctctgaatcatgtgcccgccatg
ggtacactgtgtaatattggcaatacatgctatctgaattccgtggtgtatacgctacga
tttgcgccgcacttcttgcataatctgcatcatctcattcatgatctgcatgtggtgcag
cagacaatagtgcgccggcacaatgccaagtcggcatcgctgggccgcaatgtgagcggc
ggtggtcaattagagcatgcgcgcagctggagcagcaaagatctggccaacgccgatccg
tacattagcagcaccagcaatggcagcggcagcggtagcggcagcggcaccaacagcacc
agcagtggcagcagaaagtcatcacatcaatcggttagcgagaaattgcatgagctgtat
aacaacctgcacggcaatgagatgatcgattcgagtgagccctaccatgcggacaccctg
ctgcatgccatacaggatgtcaatgccaccttcgagggcaatcagcaacaggatgcgcac
gagtttctaatgtgcgtactcaattgtatacgcgaaacgaatcagtcgctgatcaaggcc
attggcgaatgtccagaagtcattgcgaatggctacattgccaatccagatgatacggac
acggttgatgcactggaccgcacggatgcgggcaatcatgcgctgatgggcgcctctggc
aatggctctatagcaactagtcaaactcaaagtaccacgacaacaaaaacatcatttttc
tcacgcaaatcaaagagaaaagacgaagtcaaatcctcgaaagcgacacgattgcagtca
ccgctcaaggataatagtccaacaacagccggcggcggtggcatggcaagcacacatgcc
gccgcctccaatagtcttttctatttgaatacagtcgatctcagcggcgccagcgctgcg
gcaacagcttcagctgcatcgaacgcaccagcaaaatattccagtgatgatgaaattaat
acggctagtctgcttaaggataaaatgcgtctggaggagcgtatacgtgagctgaatcta
aacttcttcagctccgactttgagggcattgtggtgctgaccaccaaatgcctgagctgt
gagacaattacacgtcagaagcagggcatgctcgatatttcagtacctgtgccgatttcg
ggctatgacaatgccgaattgcaggaaaaacccagcgcctatatacagaactcatgcata
acacgtgaatattttcgcggcgataataaatacagctgcaatcagtgtacggggtacact
gaggccatacgctccatatcgtacgaggtgctgccgcgtctattggtcatccagctgaat
cgtttctcgggcggcatggagaaggttagcacctatgtgcccaccacattcacgctgccc
tgcttctgtgccaagtgctgtgagctgagcgatgccaacaagctgcatgtctataagctg
tacagcgttatcacgcatgtgggcgccacgttaaccgtgggtcattatatagcatacacc
tgctttctggatttggccagtgattatgtcaactgtcccaaggatcgtcgcaatgcaaca
agcagcgcacagcaacagcagtcagcggcaacagcggcagctggcaatgagaatgcggcg
ccgagcaataatggcagcagcagcattgccagcacgcccgtcgtctcggcggccgcctcg
gcgttggcctcgtcgggcaccagcttgataaagaaaatgaaatttggacgcagtaaggca
tccagcagcggcgacatgagcaaaaatgtgaagcaactaaatggcttgaccagcaaaacg
atcaccaatggcattggcaagctgagcatgaacacaacatgccatggcgtcaactgttgc
gccatgcgtctgtgctgtagccaacaggccagcaccgcgggcagcaatagcgccagcagc
agcgatttcagcgaggaatccctgcagaatggcagcaacagcaatctcagctatggcagc
gtgcccaacaattgtgcgccatatcccacgggctatggcagcacgggacgtggcggtgtc
aaggccaactatgcacagagcagcagcgaacccatttggtatatgtgcgacgatgataag
atcaaggcgatgacacagcgtgaattcgaggagctgctgtcgccgacgcgcaaaatcaca
ataacaccatatttgctgttctatgcacgattcgatctgcagcagccgacgcagacgacg
ccgcccaagtcgtgcgcatcgtcgacgccaacaccaccgccggcgatgtcgtccgcagca
gcagcagcagcatcggcgcagccaccgcagagcacctggtcgaatgatagcctgcaaggt
ggcctgcacaagatttga

DBGET integrated database retrieval system